(data stored in ACNUC1104 zone)

EMBL: CP002417.PE69

CP002417.PE69        Location/Qualifiers
FT   CDS_pept        67280..68188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0069"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_0064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34292"
FT                   /db_xref="GOA:E6UXU8"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU34292.1"
FT                   /translation="MTSTPAPSNYYGASRLMRAMRFGLGASQRLWPALGVRAAYRVFGT
FT                   PLPPKWLYRGQHPGTDWRHEAWSFEDASVGIYHLAAQDSGAESAPVVLLVHGWGGHAGQ
FT                   MLPLAQALAAVGLRPVLLELPAHGRSEGTATNGAQFARAIDYVTARLAADGRALRAVVA
FT                   HSLGANALAYAAGRGLPAERIVLLAPPASPREYTRYFAHAFGLSEQTRAAMQRMFEARE
FT                   GVLMPQFEPALAGPRIAQPTLIVHDRDDRVNRFADGEAYRDAIPRAQLFVTQGWGHRRI
FT                   LKEEAVLAQVTQFLVQPSAVM"
     atgacaagca cacccgcccc ttcgaactac tacggcgcca gccgcctgat gcgcgcgatg        60
     cgcttcggcc tcggcgcatc gcaacgcctc tggccggcac tgggcgtgcg cgcggcttac       120
     cgcgtgttcg gcacgccgct gccgcccaag tggctctacc gcgggcagca ccccggcacc       180
     gactggcggc acgaggcctg gtccttcgaa gacgcgagcg tgggcatcta ccacctggcg       240
     gcgcaggatt cgggcgcgga atccgcgccg gtcgtgctgc tggtgcacgg ctggggcggg       300
     catgcgggcc agatgctgcc gcttgcgcag gcgctggcgg cggtgggcct tcggccggtg       360
     ctgctcgaac tgcccgcgca cggccgcagc gaaggcacgg cgaccaacgg tgcgcagttc       420
     gcgcgcgcca tcgactacgt caccgcccgg ctcgccgcgg acggccgcgc gttgcgcgcc       480
     gtggtcgcgc attcgctggg cgccaatgcg ctcgcctatg ccgcggggcg cgggctgccg       540
     gccgagcgca tcgtgctgct cgcaccgccc gcgtcgccgc gcgaatacac gcgctacttc       600
     gcgcacgcct tcggcctcag cgagcagacg cgtgccgcga tgcagcggat gttcgaggcg       660
     cgcgaaggcg tgctgatgcc gcaattcgag ccagcgctcg ccggcccgcg cattgcgcag       720
     ccgacgctga tcgttcatga ccgcgacgac cgcgtgaacc gtttcgccga cggcgaggct       780
     taccgcgatg cgattccccg cgcgcagctc ttcgtcacgc agggctgggg ccaccgccgc       840
     atcctgaagg aagaggccgt gcttgcacag gtcacgcaat tcctggtgca gccttcggcg       900
     gtcatgtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page