(data stored in ACNUC1104 zone)

EMBL: CP002417.PE72

CP002417.PE72        Location/Qualifiers
FT   CDS_pept        72267..73916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0072"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: rme:Rmet_4338 rhodanese-like protein
FT                   sulfurtransferase; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34295"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV1"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU34295.1"
FT                   /translation="MNSSASTTLAPVLLQALLLAEPAGELALLDVRETRWFVQRHPNLA
FT                   RNAPLSGLELQVGAFVPRRSTPVVLYDDYNAPDGPAQAAVAVLARLGYTDVRTLDGGLQ
FT                   RWVTEGLPAIDGYGTLVKAFGDLARLHYGTPSLSVDALRARRREGLPATLIDARPRAEF
FT                   EFLSLPGARNHAGTELALRRFEADDAEHVWAINCFSRTRGIIGATTLRLLGRAPDAVFV
FT                   EDGVMAWGLQGAPTVQNAVPDDELPPESPEVLRRTADELLERFALPVADAAQLASWCAD
FT                   DTRSLYIFDVRPTADPAFADTAVQQVPGGQLFMHFENLVGTRGARIVLIDDPAHRLRAA
FT                   VTSFWLTQLNQAEVYVYDGALSPEQAPPAQAVTVSDAPSPLDAEALAQLRRNGAVTVID
FT                   VGASLDYERGHLPGALYMLPASLGPLASHAVAGRTLVFTSPDGAAARRVARDAQQRWPG
FT                   SGAVFTWLRGGTEAWKASGRPLSTAFVPAQLLTPFDDDWGSVMRVFGPRRDAVWVDYLA
FT                   WERALAARVLQDPSVRFRFFPTGQVPDRAARS"
     atgaacagca gcgcttccac gaccctcgca cccgtgctgc tgcaggcgct gttgctggcc        60
     gaacccgccg gcgaactggc cttgctggac gtgcgcgaaa cccgctggtt cgtgcagcgc       120
     catcccaacc tcgcgcgcaa cgcgccgctc agcgggctcg aactgcaggt cggcgccttc       180
     gtgccgcgcc gttccacgcc cgtggtgctt tacgacgact acaacgcacc cgacggtccg       240
     gcgcaggctg cggtcgcggt tctcgcgcgg ctcggctaca ccgacgtgcg cacgctcgac       300
     ggcggcctgc agcgctgggt gaccgagggc ctgcccgcca tcgacggcta cggcacgctg       360
     gtcaaggcct tcggcgatct cgcgcggctg cactacggca cgccttcgct gtccgtcgac       420
     gccctgcgcg cacgccggcg cgaaggcctt cccgccacgc tgatcgatgc acggccgcgc       480
     gcggaattcg aattcctctc gctgcccggc gcgcgaaacc acgccggcac cgagctcgcg       540
     ctgcgccgct tcgaggcgga cgatgcggaa cacgtctggg cgatcaactg cttcagccgc       600
     acgcgcggca tcatcggcgc caccacgctg cggctgctcg gccgcgcgcc cgatgcggtg       660
     ttcgtcgagg acggcgtgat ggcctggggc ctgcaaggtg cgccgacggt gcagaacgcg       720
     gtgcccgacg acgagcttcc gcctgaatcc cccgaggtgc tgcgacgcac cgccgacgag       780
     ctgctcgagc gtttcgccct tcccgtggcc gacgccgcac agctcgccag ctggtgcgcc       840
     gacgacacgc gcagcctcta catcttcgac gtgcgcccca cggccgaccc ggccttcgcg       900
     gacacggcgg tgcagcaagt ccccggcggc cagttgttca tgcacttcga gaacctcgtc       960
     ggcacgcgcg gcgcccgcat cgtgctgatc gacgatccgg cgcaccgcct gcgcgcggcg      1020
     gtcacgagct tctggctcac gcagttgaat caggccgagg tgtacgtcta cgacggtgcg      1080
     ctgtcgccgg agcaagcgcc cccagcgcaa gctgtcaccg tgtcggatgc accctcaccg      1140
     ctggatgccg aagccctcgc tcaactgcgc aggaacggcg cggtaacggt gatcgacgtg      1200
     ggcgcgagcc tcgactacga acgcggccac ctgcccggcg cgctctacat gctgcccgcc      1260
     tcgctgggcc cgctggcctc gcacgccgtg gccggccgca cgctggtctt cacctcgccc      1320
     gacggcgcgg ccgcgcgccg tgtcgcgcgc gatgcgcaac agcgctggcc gggttcgggg      1380
     gcggtgttca cctggctccg gggcggaacc gaggcgtgga aggcgtcagg acggccgctg      1440
     tcgaccgcgt tcgtcccggc ccagctcctc accccgttcg acgacgactg gggctcggtc      1500
     atgcgcgtct tcggcccgcg ccgcgatgcg gtctgggtcg actatctcgc gtgggagcgg      1560
     gcgctggctg cgcgggtcct gcaggacccg tcggtgcgct ttcgcttctt tcctaccggg      1620
     caggtgccgg atcgggcagc tcgatcttga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page