(data stored in ACNUC1104 zone)

EMBL: CP002417.PE75

CP002417.PE75        Location/Qualifiers
FT   CDS_pept        complement(75022..75789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0075"
FT                   /product="septum site-determining protein MinC"
FT                   /note="KEGG: vap:Vapar_0067 septum site-determining protein
FT                   MinC; TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34298"
FT                   /db_xref="GOA:E6UXV4"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV4"
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /protein_id="ADU34298.1"
FT                   /translation="MADVSAARTKAVFEFKSATLPLIAVILKTSDLDVLAEALDAQLAD
FT                   SPDFFEQEPVVIDLSQLPEHDEAGEATAQIDFAALRSLLARHQTQPIAVRGGNDTQNAA
FT                   ARAAGLSLAAMPSAPAPRPPAPPAEAPAEAPQIIREVPVPANGTLLIDKPLRSGQQVYA
FT                   RGGDVVVTAVVSFGAEVIADGNVHVYAPLRGKAIAGARGNTEARIFSTCMEAQLVAIAG
FT                   IYRTNEVPLPDPVLGKSAQVRLDGKKLVIDAIP"
     atggccgatg tctccgccgc gcgcaccaag gcggttttcg aattcaagag cgccacgctg        60
     ccgctgattg cagtgatcct caagacgtcc gacctggacg tgctggccga ggcgctcgac       120
     gcccagcttg ccgattcgcc cgacttcttc gagcaggagc cggtggtgat cgacctctcg       180
     cagctccccg agcacgacga agcgggcgaa gccaccgccc agatcgactt cgcggccctg       240
     cgcagcctct tggcgcgcca ccagacccag ccgatcgcgg tgcgcggcgg caacgacacc       300
     cagaatgccg cggcccgcgc cgccggtctc tcgctggcgg ccatgccctc ggcgcccgcg       360
     ccccggccgc cggccccgcc cgccgaggcg ccggccgaag ccccccagat cattcgcgaa       420
     gtgccggtgc cggccaacgg cacgctcctc atcgacaagc cgctgcgctc gggccagcag       480
     gtctacgccc gcggcggcga cgtggtggtg acggccgtgg tgagcttcgg cgccgaagtc       540
     atcgccgacg ggaacgtgca tgtgtacgcg ccgttgcgcg gcaaggcgat tgcaggcgcg       600
     cgcggcaaca ccgaggcgcg gatcttctcg acctgcatgg aagcgcagct cgtggccatc       660
     gccggcatct accgcacgaa tgaagtgccg ctgcccgacc cggtgctcgg caagtcggcg       720
     caggtgcgct tggatggcaa aaagctagtg atcgacgcga tcccctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page