(data stored in ACNUC1104 zone)

EMBL: CP002417.PE76

CP002417.PE76        Location/Qualifiers
FT   CDS_pept        complement(75948..77231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0076"
FT                   /product="uracil-xanthine permease"
FT                   /note="KEGG: vap:Vapar_0068 uracil-xanthine permease;
FT                   TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34299"
FT                   /db_xref="GOA:E6UYX0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX0"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ADU34299.1"
FT                   /translation="MFNWTEKPVSTLADGAVIGPDERLPWLQTGAMGIQHVIAMFGATV
FT                   LAPILMGFSPNIAILMSGIGTLIFYFVTGGKVPSYLGSSFAFIGVVIAASGYAGKGPNA
FT                   NIAVALGGIVACGVVYILIGALVQAIGTGWIERFMPPVVTGAVVAVIGLNLASVPIKNM
FT                   AASNFDSWMQAVTFLCVGLVAVFARGMLQRLLILVGLILATVVYAVLTNILGMGKPVDL
FT                   SDIANAAWFGLPTFTTPVFTANAMLLIAPVAIILVAENLGHLKAVTAMTGRNLDPYMGR
FT                   AFIGDGIATVVSGAAGGTGVTTYAENIGVMAATRIYSTAVFVVAAVIALVLGFSPKFGA
FT                   LIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNKVDFSQNKNLIVAAITLIIGTGDFTLK
FT                   FGDFALGGIGTATFGAIILYALLGKTKN"
     atgttcaact ggactgaaaa gccggtgtcc acactggccg acggcgcggt catcgggccc        60
     gacgagcggc tgccctggct gcagaccggc gcgatgggca tccagcacgt gatcgcgatg       120
     ttcggcgcca cggtgctggc gccgatcctc atgggcttca gccccaacat cgcgatcctg       180
     atgagcggga tcggcacgct gatcttctat ttcgtcaccg gcggcaaggt gcccagctac       240
     ctgggctcga gcttcgcctt catcggcgtg gtgatcgcgg ccagcggcta cgcgggcaag       300
     gggcccaacg ccaacatcgc ggtggcgctc ggcggcatcg tggcctgtgg ggtggtctac       360
     atcctgatcg gggcgctggt gcaggccatc ggcacgggct ggatcgagcg cttcatgccg       420
     cccgtggtca ccggcgccgt ggtggcggtg atcgggctca acctggccag cgtgccgatc       480
     aagaacatgg cggccagcaa cttcgattcg tggatgcagg ccgtgacctt cctgtgcgtc       540
     gggctggtgg cggtgttcgc gcgggggatg ctgcagcgcc tcttgatcct ggtcggactg       600
     atcctggcca ctgtcgtcta tgcggtgctc acgaacatcc tgggcatggg caagccggtg       660
     gacctgagcg acatcgccaa cgcagcctgg ttcggcctgc cgaccttcac cacgccggtg       720
     ttcaccgcca acgcgatgct gctgatcgcg cccgtggcga tcatcctcgt ggcggaaaac       780
     ctcggccacc tgaaggcggt gacggccatg accggccgca acctcgaccc ctacatgggc       840
     cgcgccttca tcggcgacgg catcgccacc gtggtgagcg gcgccgcggg cggcacgggc       900
     gtgacgacct atgccgagaa catcggcgtg atggcggcca cgcgcatcta ctcgacggcg       960
     gtgttcgtgg tggcggcggt gatcgcgctc gtgctgggct tcagccccaa gttcggcgcg      1020
     ctgatccagg cgattccgct gccggtgatg ggcggcgtga gcatcgtggt gttcggcctg      1080
     atcgcgattg ccggcgccaa gatctgggtc gacaacaagg tcgacttctc gcagaacaag      1140
     aacctgatcg tggccgcgat cacgctgatc atcggcacgg gcgacttcac gctgaagttc      1200
     ggcgacttcg ctttgggcgg catcgggacc gcgactttcg gggcgatcat cctttacgca      1260
     ctgctgggca agacgaagaa ttga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page