(data stored in ACNUC1104 zone)

EMBL: CP002417.PE81

CP002417.PE81        Location/Qualifiers
FT   CDS_pept        complement(81340..82728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34304"
FT                   /db_xref="GOA:E6UYX5"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX5"
FT                   /inference="similar to AA sequence:KEGG:Daci_0285"
FT                   /protein_id="ADU34304.1"
FT                   /translation="MIEAALLNQILVATGMGLVGAIVFAAIGLVSGTDETTTLAPLTLL
FT                   VVLLGVPPEGVFTFFLAAAVAKHMTHAVPTALLGIPGDTMATPLLQDANVLRNLGVPHI
FT                   ALRKMVSGAIIAAFIAVPLAVLFAVLLAPYGAAITKAAPWIFVVAAVAIAYFSSGRWAS
FT                   VATLVPFVMVIVALQALTGKYGVKLSISYFLGIAIGPLVADLFSVISPAARARMKRDKV
FT                   RTFSLAPDVKGWTGYFPNPFKVLDRTQVKWTFATATISSATFVFSPVAMTVVLGELVGS
FT                   RIKHAYHRLTTTLAARNGVTEATYIAEALIPLIAIGLPLSPVAAGPAAPLFNAPPVFTI
FT                   DSATGQTHNLHNLLNHWEFLGYGMLAVVLAALVAYPFTMNFARRAALFVSRKVSHEAII
FT                   ATFVGLIVVISVWEGQLLGLLVILTMGLLGGLLSRAIGFNTGVQFMGYYTAVLTVPAVI
FT                   KAFS"
     gtgatcgaag ccgcactcct caaccagatc ctcgtcgcca ccggcatggg cctcgtgggc        60
     gccatcgtgt tcgcggccat cggcctcgtc tcgggcaccg acgaaaccac cacgctcgcg       120
     ccgctcaccc tgctggtggt gctgctgggc gtgccgcccg aaggcgtgtt caccttcttc       180
     ctggcggccg cggttgccaa gcacatgacg cacgcggtgc ccactgcgct gctgggcatt       240
     ccgggggaca ccatggccac gccgctgctg caggacgcca acgtgctgcg caacctgggc       300
     gtgccgcaca tcgcgctgcg caagatggtg tcgggcgcga tcatcgcggc cttcatcgcg       360
     gtgccgctgg ccgtgctgtt cgcggtgctg ctcgcaccct acggcgcggc catcaccaag       420
     gcggcgccgt ggatcttcgt ggtcgcggcc gtggccatcg cctacttctc gagcgggcgc       480
     tgggcatcgg tcgccacgct ggtgccgttc gtgatggtga tcgtggcgct gcaggcgctc       540
     accggcaagt acggcgtgaa gctcagcatc agctacttcc tgggcatcgc catcggaccg       600
     ctggtggcgg acctgttctc ggtgatctcg ccagcggcgc gtgcgcgcat gaagcgcgac       660
     aaggtccgca ccttctcgct cgcacccgat gtgaaaggct ggacgggcta cttcccgaac       720
     ccgttcaagg tgctcgaccg cacgcaggtg aaatggacct tcgcgaccgc cacgatctcc       780
     agcgccacct tcgtgttcag cccggtcgcg atgaccgtgg tgctgggcga actggtcggc       840
     tcacgcatca agcacgcgta ccaccgcctc accaccacgc tggccgcgcg caacggcgtg       900
     accgaggcga cctacatcgc cgaggcactg atcccgctga tcgccatcgg cctgccgctg       960
     agccctgtcg cggccggccc cgccgcaccg ctcttcaacg cgccgccggt gttcaccatc      1020
     gactcggcca cgggccagac gcacaacctg cacaacctgc tgaaccactg ggagttcctc      1080
     ggctacggca tgctggcggt ggtactcgcg gcgctggtgg cttacccgtt cacgatgaac      1140
     ttcgcgcgcc gcgcggcgct gttcgtctcg cgcaaggtga gccacgaggc gatcatcgcg      1200
     accttcgtcg ggttgatcgt ggtgatcagc gtgtgggaag gccagctgct cggcttgctg      1260
     gtgatcctca cgatgggtct gctcggcggg ctgctgtcgc gcgccatcgg gttcaacacc      1320
     ggggtgcagt tcatgggcta ctacacggcg gtgctgacgg tgccggcggt gatcaaggcg      1380
     ttttcgtag                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page