(data stored in SCRATCH zone)

EMBL: CP002417.PE82

CP002417.PE82        Location/Qualifiers
FT   CDS_pept        complement(82725..83177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34305"
FT                   /db_xref="GOA:E6UYX6"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX6"
FT                   /inference="similar to AA sequence:KEGG:Daci_0286"
FT                   /protein_id="ADU34305.1"
FT                   /translation="MNADSATPTRWRLVEIWGDTADLGHLAWSIVIGVAVSLTGYLVAS
FT                   RVLASVVSTPELARAYAMLAGLGGCVVSGVICAKLFAPKREVVEGTDPDPRWREEVLAE
FT                   LAGEHGDLGSVDDLPPSVAREMKELEIYDLFASYKPRAKSIEGAAS"
     atgaacgcag acagtgcaac gcccacgcgg tggcggctgg tggagatatg gggcgacacg        60
     gccgacctgg ggcacctcgc gtggtccatc gtcatcggcg tcgcagtgag cctcacgggt       120
     tacctcgtgg cgagccgcgt gctcgcgagc gtggtcagca cgcctgagtt ggcgcgcgcc       180
     tacgccatgc tcgcgggcct cggcggctgc gtggtgtcgg gggtgatctg cgcgaagctc       240
     ttcgcaccga agcgcgaagt ggtcgagggc acggaccccg atccgcgctg gcgtgaagag       300
     gtgctggccg agcttgctgg cgaacacggc gacctgggct ccgtggacga cctgccgccc       360
     tcggtggcgc gcgaaatgaa ggagctggaa atctacgacc tgttcgcgtc gtacaagccc       420
     cgcgccaaga gcatcgaagg agccgcctcg tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page