(data stored in ACNUC1104 zone)

EMBL: CP002417.PE83

CP002417.PE83        Location/Qualifiers
FT   CDS_pept        complement(83272..84558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0083"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="KEGG: dac:Daci_0287 hydroxymethylglutaryl-CoA
FT                   reductase, degradative; TIGRFAM: hydroxymethylglutaryl-CoA
FT                   reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34306"
FT                   /db_xref="GOA:E6UYX7"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX7"
FT                   /inference="protein motif:TFAM:TIGR00532"
FT                   /protein_id="ADU34306.1"
FT                   /translation="MVADSRIPNFRALTPAQRFAHIAKAASLTDDEVALLAQPGALSVD
FT                   RANGMVENVIGTFELPLGVAGNFTVNGRDYLVPMAVEEPSVVAAASFMAKLAREGGGFE
FT                   ASSTGPLMRAQVQVIGITDPYGARLALLRAREEILAVANSRDKVLIDLGGGCRDIEVHV
FT                   FGDTPRGAMVVMHLIVDVRDAMGANTVNTMAEAVSPLVEKLTGGTVRLRILSNLADLRL
FT                   ARARVRLAPAVLATRERSGEEVVEGVIDAYTFAAIDPYRAATHNKGIMNGVDPVIVATG
FT                   NDWRAVEAGAHAYACRSGRYTSLTTWEKDTTGALVGTIEMPMPVGLVGGATKTHPLARL
FT                   ALKILDVKSAQELGEVAVAVGLAQNLGALRALATEGIQRGHMALHARNIALVAGATGDE
FT                   IDSIAKQMAAEHDVRTDRAVALLEALRKK"
     atggtcgccg actcccgcat tcccaatttc cgtgccctca cgcccgcgca gcgcttcgcc        60
     cacatcgcca aggccgcatc gctcaccgac gacgaggtgg ccctgctcgc ccagcctggc       120
     gcgctgagcg tggaccgcgc caacggcatg gtggagaacg tgatcggcac cttcgagctg       180
     ccgctgggcg tggccggcaa cttcaccgtg aacggacgcg actacctcgt gccgatggcg       240
     gtggaagaac cttcggtggt cgccgccgca tcgttcatgg ccaagctggc gcgcgaaggc       300
     ggcggcttcg aggcctcgag caccgggccg ctgatgcgtg cgcaggtgca ggtgatcggc       360
     atcaccgacc cctacggcgc gcggctcgcg ctgctgcgtg cgcgcgaaga aatcctggcc       420
     gtggcgaaca gccgcgacaa ggtgctgatc gatctcggcg gcggctgccg cgacatcgag       480
     gtgcatgtgt tcggcgacac gccgcgtggc gcgatggtgg tgatgcacct gatcgtcgac       540
     gtgcgcgacg cgatgggcgc gaacaccgtc aacaccatgg ccgaggcggt gtcgccgctg       600
     gtcgagaaac tcacgggcgg cacggtgcgc ctgcgcatcc tgtcgaacct ggcggacctc       660
     aggctggcgc gtgcgcgcgt gcggctcgcg cctgccgtgc tggccacgcg cgagcgcagc       720
     ggcgaagagg tggtcgaggg cgtgatcgat gcgtacacct tcgcggccat cgacccctac       780
     cgcgcggcga cgcacaacaa gggcatcatg aacggcgtcg atccggtgat cgtcgcgacc       840
     ggcaacgact ggcgcgcggt ggaagccggc gcacacgcct acgcctgccg tagcgggcgc       900
     tacacgtcgc tcaccacgtg ggagaaggac acgacgggcg cactcgtcgg caccatcgag       960
     atgccgatgc cggtgggctt ggtcggcggc gccaccaaga cgcacccact cgcgcgcctc      1020
     gcattgaaga tcctcgatgt gaagtccgcg caggagttgg gcgaagtcgc ggtggccgtg      1080
     ggcctggcgc aaaacctcgg cgccttgcgc gcgctcgcca ccgaaggcat tcagcgcggc      1140
     cacatggcgc tgcatgcccg caacatcgcg ctggtcgcgg gcgccaccgg cgacgagatc      1200
     gacagcatcg ccaagcagat ggccgccgag cacgacgtgc gcaccgatcg cgccgtcgcg      1260
     ctgctcgaag cattgcgcaa gaagtaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page