(data stored in SCRATCH zone)

EMBL: CP002417.PE85

CP002417.PE85        Location/Qualifiers
FT   CDS_pept        complement(86086..86868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0085"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rsl:RPSI07_mp0572 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34308"
FT                   /db_xref="GOA:E6UYX9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34308.1"
FT                   /translation="MAMEYVSYDTDRAVCTLTLNRPDKRNAVNGIVAAELREAFERFDA
FT                   DDALRVAILTGAGGHFCAGADLGAVGNPDERNELDPEGGGSGPMGPTRMALSKPLIAAV
FT                   NGYAVAGGLELALLADLRVADDDAVFGVFCRRWGVPLIDGGTVRLPRIVGMGRALDMIL
FT                   TGRPVSATEALAMGLVNRVTPPGGALAAARELALQIAAFPQQCMLTDRRSAYEQWDLPL
FT                   AEALRREGAQGVPIVFAEGEAGAARFAGGAGRHGTFKG"
     atggctatgg aatacgtgag ctatgacacg gatcgggcgg tctgcactct cacgctgaac        60
     cgtcccgaca agcgcaatgc cgtcaacggc atcgtggccg ccgagctgcg cgaagccttc       120
     gagcgcttcg atgccgacga tgcgctgcgc gtggcgatcc tcacgggcgc gggcggccat       180
     ttctgcgccg gtgccgacct gggcgccgtc ggcaacccgg acgaacgcaa cgagctcgac       240
     cccgagggcg gcggcagcgg gccgatgggg ccgacgcgca tggcgttgtc caagccattg       300
     atcgcggctg tgaacggcta tgcggtcgcg ggcggcctcg agctcgcgct gcttgccgac       360
     ctgcgcgtgg ccgacgacga tgcggtcttc ggggtgttct gccgccgctg gggcgtgccg       420
     ctgatcgacg gcggcacggt gcgactgccg cgcatcgtgg gcatggggcg cgcgctcgac       480
     atgatcctca ccggacgtcc ggtctccgcc accgaggcgc tggcgatggg cctggtcaac       540
     cgtgtcacgc caccgggcgg cgcgctcgct gcggcgcggg aactggcact gcagatcgcc       600
     gcgttcccgc agcaatgcat gctcaccgac cggcgctccg cctacgagca gtgggacttg       660
     ccgctggccg aggcgctgcg acgcgaaggc gcgcagggcg tgccgatcgt ctttgccgaa       720
     ggcgaagctg gtgccgcacg cttcgccggc ggcgcggggc ggcacggcac gttcaagggc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page