(data stored in SCRATCH zone)

EMBL: CP002417.PE86

CP002417.PE86        Location/Qualifiers
FT   CDS_pept        86948..87754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0086"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: rpe:RPE_1212 PaaX domain-containing protein,
FT                   C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34309"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY0"
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /protein_id="ADU34309.1"
FT                   /translation="MEKICNVPVAIPSAPELILDLLVAHSGMLSAQSLCRAGALMGIGE
FT                   STLRVGLTRLASDGKIERSERGSYALNRAGPALSRAVDGWRQRGAQAVAWRNDWLAVHD
FT                   AGVPRSDKTAWRHHGLALSLRGFAPLQAGLHIRPDNLRGGLAAERGQLQGLGLSSKALV
FT                   FRLADMDEATQAAARKLWNVRALTAGYQRLQTGIERSEKRLDKLSLEAAVRESLLLGRA
FT                   VIAHLIRDPLLPAELMSPAPRTALQAVTRRYQDKARKLWRAWFAEA"
     gtggaaaaaa tatgcaatgt tccggtcgcc attcccagcg cgccggaact gatcctcgac        60
     ctgctcgtcg cccacagcgg catgctgagc gcgcaatcgc tgtgccgcgc gggcgccttg       120
     atgggcatcg gcgaatccac gctgcgcgtg ggcctcacgc ggctcgcgag cgacggcaag       180
     atcgaacgca gtgagcgcgg cagctatgcg ctcaaccgcg cggggccggc gctgtctcgc       240
     gcggtcgatg gctggcggca gcgcggcgcg caggccgtcg catggcgcaa cgactggctc       300
     gcggtgcacg acgcgggcgt gccgcgttcg gacaagacgg cctggcgcca ccatgggctg       360
     gcgctgtcgc tgcgcggctt tgcgccgttg caggccggcc tgcacatccg gcccgacaac       420
     ctccggggcg ggctggcagc cgagcgcgga cagctgcagg gcctcggcct gtcctcgaag       480
     gcgctggtgt tccgcctcgc cgacatggac gaagccacgc aggctgccgc gcgcaagctg       540
     tggaacgtgc gagcgttgac ggccggctac cagcgtctgc agaccggcat cgagcgcagc       600
     gagaagcggc tggacaagct gtcgctcgaa gcggcggtgc gcgagtcgct gctgctcggg       660
     cgcgctgtca tcgcgcatct catccgcgat ccgctgctgc cggccgaact catgtcgccg       720
     gcgccgcgca ccgcactgca ggccgtcacg cgccgctacc aggacaaggc gcgcaagctg       780
     tggcgcgcgt ggttcgcaga ggcctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page