(data stored in SCRATCH zone)

EMBL: CP002417.PE88

CP002417.PE88        Location/Qualifiers
FT   CDS_pept        complement(89718..90704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0089"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   KEGG: vap:Vapar_0072 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34311"
FT                   /db_xref="GOA:E6UYY2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY2"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADU34311.1"
FT                   /translation="MDDEGREPLRAVEIMTHLNVQRVAVVGTGVIGASWTAYFLAQGLD
FT                   VNATDPSPGAEDRLRAAVAQHWPTLERFGLAEGASVDRLRFHDSLEDAVSVADFVQENG
FT                   PERMDFKIDLFRRMDAAAPPETILASSSSGLAISGVQSGCAHPQRVVLGHPFNPPHLIP
FT                   LVEVIGGEKTSADTIERTMAFYAAIGKRPIHVKREVKGHIANRLQAALWREAFHLVNEG
FT                   VASVADIDTAIAHGPGLRWAVMGPFMNLHLSGGAGGIEHVLAHLGGPIEDWWKDLGAPS
FT                   MTAELKQKVAAGVAEELGARRTSDLEAARDTLLLNLIRAKADTGKLD"
     atggacgacg aaggcagaga gccgctgcgc gcggtggaaa tcatgaccca cttgaatgtg        60
     caacgtgtcg cggttgtcgg caccggcgtg atcggtgcga gctggaccgc gtatttcctt       120
     gcgcaagggc tcgacgtgaa cgcgaccgat ccatcgcccg gcgccgaaga caggttgcgc       180
     gccgccgtcg cgcagcactg gccgacgctg gagcgctttg ggcttgccga gggcgcatcg       240
     gtggatcgct tgcgctttca cgacagcctg gaagacgcag tgtcggtggc cgacttcgtg       300
     caggagaacg gccccgagcg catggacttc aagatcgacc tgttccgccg catggacgcg       360
     gcagcgccgc cggaaaccat cctcgcgtcg agttcgtcgg gcctcgcgat cagtggcgtg       420
     caatcgggct gcgcgcatcc gcaacgcgtg gtgctcgggc atccgttcaa tccgccgcac       480
     ctgattccac tggtggaggt gatcggtggc gagaagacct cggccgacac catcgaacgc       540
     acgatggcgt tctatgcggc catcggcaag cggccgatcc atgtgaagcg cgaggtcaag       600
     ggccacatcg cgaaccggct gcaagctgcg ctgtggcgcg aggcctttca cctcgtcaat       660
     gagggcgtgg cgagcgtggc ggacatcgac acggcgattg cgcacggccc gggcctccgc       720
     tgggcggtga tggggccgtt catgaacctg catctctcgg gcggcgcggg tggcatcgaa       780
     catgtgctcg cgcacctggg cgggcctatt gaggactggt ggaaggacct gggcgcgccg       840
     tcgatgacag ccgaactcaa gcagaaggta gccgcgggcg tcgcagagga actgggtgcg       900
     cgccgcacca gcgacctcga agccgcacgc gacaccctgc tgttgaacct gattcgcgcg       960
     aaagccgaca ccggcaaact cgactga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page