(data stored in SCRATCH zone)

EMBL: CP002417.PE89

CP002417.PE89        Location/Qualifiers
FT   CDS_pept        complement(90659..91873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0090"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ctt:CtCNB1_0215 putative substrate-binding periplasmic
FT                   (pbp)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34312"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34312.1"
FT                   /translation="MNITLSRTALAVALGAAFTTTGASAQVSDDTIRIGFISDMSGIYR
FT                   DYDGPAGAEAIRMAIADMGGAIDGRKIELVTADHQNKPDIAAAKAREWFDVQKVDMLIA
FT                   GVNSGAAIAMAGVAADKKKPYFVVGSGASSLTNEYCSPYTVHYAYDTVAMARGTATAVV
FT                   KAGGKSWYFVTADYAFGAALQTDAAKIINASGGTVAGSVKHPLGASDFSSFMLQAQGSK
FT                   AQVLALANAGGDTVNAIKSAAEFGISKNMKLAGMIITINDVHALGLKTSQGMYLTDSWY
FT                   WNQSPEARTWARRFFDKHKRMPSSFHAGDYSAALQYLQAVKAAGSDDADKVMAQLRKTK
FT                   FNDMFVKGGWLRDDGLMVHDMQLMQVKTPDESKEPWDYYKVVEPIRGEAAWTTKAESRC
FT                   ARWKS"
     atgaacatca ccctctcgcg cactgcgctc gctgtcgcac tcggcgcggc cttcaccacc        60
     accggcgcct cggcgcaggt gtcggacgac accatccgca tcggcttcat cagcgacatg       120
     tcgggcatct accgcgacta cgacggcccg gccggcgcgg aggccatccg catggccatt       180
     gccgacatgg gcggcgccat cgacggcagg aagatcgagc tggtcacggc cgaccatcag       240
     aacaagcccg acatcgcagc cgccaaggca cgcgagtggt tcgacgtgca gaaggtcgac       300
     atgctgatcg cgggcgtcaa ctcgggcgcg gcgattgcca tggcgggcgt ggcggccgac       360
     aagaagaagc cgtacttcgt ggtcggctcg ggcgcatcga gcctcaccaa cgaatactgc       420
     tcgccctaca cagtgcacta cgcctacgac acggtggcga tggcgcgcgg caccgcgacc       480
     gcggtggtca aggcgggcgg caaaagctgg tacttcgtca ccgccgacta cgccttcggc       540
     gccgcgctgc agaccgacgc ggccaagatc atcaacgcca gcggcggcac ggtcgcgggc       600
     tcggtgaagc acccgctggg cgcgagcgat ttctcgtcgt tcatgctgca ggcgcagggc       660
     tcgaaggcgc aggtgctggc gctcgccaat gcgggcggcg acacggtgaa cgcaatcaag       720
     tcggcggcgg aattcggcat cagcaagaac atgaagctgg ccggcatgat catcaccatc       780
     aacgatgtgc acgcgctggg cctgaagacc tcgcagggca tgtacctcac cgacagctgg       840
     tactggaacc agagccccga ggcgcgcacc tgggcgcggc gcttcttcga caagcacaag       900
     cgcatgccct cctccttcca tgccggcgac tactcggccg cgcttcaata tctgcaggcg       960
     gtgaaggcgg ccggcagcga cgatgccgac aaggtgatgg cgcaactgcg caagacgaag      1020
     ttcaatgaca tgttcgtcaa gggcgggtgg ctgcgcgacg acggcctcat ggtgcacgac      1080
     atgcagttga tgcaggtgaa gacccccgac gaatcgaaag agccgtggga ctactacaag      1140
     gtggtcgagc cgatccgcgg cgaggccgca tggacgacga aggcagagag ccgctgcgcg      1200
     cggtggaaat catga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page