(data stored in ACNUC1104 zone)

EMBL: CP002417.PE91

CP002417.PE91        Location/Qualifiers
FT   CDS_pept        92976..93689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0092"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: vap:Vapar_0075 putative transcriptional
FT                   regulator, Crp/Fnr family; PFAM: cyclic nucleotide-binding;
FT                   SMART: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34314"
FT                   /db_xref="GOA:E6UYY5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADU34314.1"
FT                   /translation="MATKKAEPPITAASLTIPQLLQGSAWFPLLDATARDRVLDEMREV
FT                   EVAAGAALCRRGDTPLHWYGTLEGLLKWSITSSDGRSVTFGGLSVGSWFGEGTLLRAVP
FT                   RSADIIALRPSRVAQLPLETFEWLHRTQRGFDHFLLQQINERLHWFMGNYAAHRLLDAD
FT                   SQVARALAGLFHPWLHPGSEPYLQTSQEEIANLSGVSRQRCNAALNRLKEAGFLRIEYG
FT                   GITVIDLDGLRRFIE"
     atggccacga agaaggcgga gccgcccatc acggcggcat cgctgaccat tccgcaactg        60
     ctgcaaggct cggcctggtt tccgctgctc gatgcgaccg cgcgcgaccg cgtgctcgac       120
     gagatgcgcg aggtcgaggt ggccgccggc gccgcgctgt gccggcgcgg cgacacgccg       180
     ctgcactggt acggcacgct cgaagggctg ctcaagtggt cgatcacctc cagcgacggt       240
     cgctcggtga ccttcggcgg cctgtcggtc ggcagctggt tcggcgaggg cacgctgctg       300
     cgcgcggtgc cgcgctcggc cgacatcatt gcgctgcgcc cgagccgcgt ggcccagctg       360
     ccgctggaga ccttcgaatg gctgcaccgc acgcagcgcg gcttcgatca tttcttgttg       420
     cagcagatca acgagcgtct gcactggttc atgggcaact atgcggcgca caggttgctc       480
     gatgcggaca gccaggtggc gcgcgcgctc gccggactgt tccacccatg gctgcatccg       540
     gggagcgagc cgtatctgca gacttcgcag gaggagatcg cgaatctttc gggcgtgtcg       600
     cggcagcggt gcaatgcggc gttgaaccgg ttgaaggagg cgggcttctt gcggatcgag       660
     tacgggggaa tcaccgtgat cgatctggac gggctgcggc ggttcatcga gtag             714
//

If you have problems or comments...

PBIL Back to PBIL home page