(data stored in ACNUC1104 zone)

EMBL: CP002417.PE93

CP002417.PE93        Location/Qualifiers
FT   CDS_pept        complement(93974..94717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0094"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0079 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34316"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34316.1"
FT                   /translation="MQDSTSPSTVVITGASSGIGLGLAAAYLERGFNVVANARTDERLA
FT                   AAAKQLGNPDRFLGVAGDIALRATAEQLIDRAVARFGHVDVLINNAGIFNAKPFVDYTE
FT                   EELDQLVATNLKGFVYASQAAAKHMIPRRKGHIVNITAGIALQPNLKVPALVPVLVKGG
FT                   INAATRALALELSPHNIQVNAVAPGIVDTPMHPAENHGFLSGLAPAGRIATVREIADAV
FT                   LYLTGAGFTSGVVLAVDGGASAGTW"
     atgcaagaca gcacttcacc ttccaccgtc gtcatcaccg gcgcctcgag cggcatcggg        60
     ctgggcctcg cggcggcgta tctcgagcgc ggcttcaacg tggtcgccaa cgcccgcacc       120
     gacgagcggc tcgcggccgc cgcaaagcag ctgggcaacc cggaccgctt tctcggcgtc       180
     gcgggcgaca tcgccctgcg tgcaacggcc gagcagctca tcgaccgtgc cgtggcgcgc       240
     ttcggccacg tcgacgtgct catcaacaac gccggcatct tcaacgccaa gcccttcgtc       300
     gactacaccg aggaagagct cgaccagctg gtcgccacca acctcaaggg tttcgtctac       360
     gcctcgcagg ccgccgcgaa gcacatgatt ccgcgccgca agggtcacat cgtgaacatc       420
     accgcgggca tcgcgctgca gccgaacctg aaggtgccgg ccctggtgcc ggtgctggtc       480
     aagggcggca tcaatgcggc gacgcgcgcc ctcgcgctcg agctctcgcc gcacaacatc       540
     caggtgaatg cggtggcgcc cggcatcgtc gacacgccga tgcatcccgc cgagaaccac       600
     ggcttcttga gcggcctggc gcccgcgggc cgcatcgcga ccgtgcgcga gatcgccgat       660
     gcggtgctgt acctcaccgg cgccggcttc acgtcgggcg tggtgctggc ggtggacggc       720
     ggcgcgagcg ccggcacctg gtaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page