(data stored in ACNUC1104 zone)

EMBL: CP002417.PE94

CP002417.PE94        Location/Qualifiers
FT   CDS_pept        94825..95736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0080 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34317"
FT                   /db_xref="GOA:E6UYY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34317.1"
FT                   /translation="MQRQFGDILLGSIELFCLAAETGGFTSAALAAGVTPAAVSRSISR
FT                   LEKRLGLRLFVRTTRSVRLTDAGRSYFAQCRQALAQLAEAEREVMGQQAQPSGTLRISV
FT                   PTTYGHHRILPMLPAFRERYPDIRLHVHLSNRNIDFVEEGYDMAVRVRAQPDSTLIARH
FT                   LEDAALVVVATRKYLKAAGTPRTPDDLAAHECIQFELPSSGRRISWLFKEEGQDREVLA
FT                   DSAYSCSDDVLGGVTLAKSGAGLFQTYRFVVQKELADGSLVEVLKPFAGRSRPYTLLYP
FT                   DGRHAPLRMRVFIDFLMAQRAA"
     atgcaacggc agttcggcga catcctcctt ggcagcatcg aactcttctg cctcgcggcg        60
     gagacgggcg gcttcacctc ggcggcgctc gccgcgggcg tgacgcctgc ggcggtgagc       120
     cgctcgatct cacgactgga gaaacgactc ggtcttcgtc tgttcgtgcg caccacgcgc       180
     agcgtgcggc tcaccgacgc gggccgctcc tacttcgcgc agtgccgcca ggcgctcgcg       240
     cagctcgccg aggccgagcg cgaagtgatg ggccagcagg cgcagccctc gggcacgctg       300
     cgcatcagcg tgccgaccac ctacggccac caccgcatcc tgccgatgct gcccgcgttc       360
     cgcgaacgct atcccgacat ccggctgcat gtgcacctga gcaaccgcaa catcgacttc       420
     gtggaagagg gctacgacat ggccgtgcgc gtgcgcgccc aaccagactc cacgctgatc       480
     gcgcggcacc tggaggacgc ggcgctcgtg gtggtcgcga cgcgcaagta cctgaaggcg       540
     gctggcacgc cccgcacgcc ggacgacctc gccgcgcacg agtgcatcca gttcgagctg       600
     cccagcagcg ggcgccgcat ttcatggctc ttcaaggagg agggccagga ccgcgaggtg       660
     ctcgcggaca gcgcctacag ctgctccgac gacgtgctcg gcggcgtcac gctcgccaag       720
     agcggcgccg ggttgttcca gacctaccgc ttcgtggtgc agaaggagct tgccgacggc       780
     tcgctcgtcg aggtactgaa accgttcgcg ggccgctcgc gcccgtacac gctgctgtac       840
     ccggacgggc ggcatgcgcc gctgcgcatg cgggtgttca tcgatttcct gatggcgcag       900
     cgcgctgcct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page