(data stored in ACNUC1104 zone)

EMBL: CP002417.PE95

CP002417.PE95        Location/Qualifiers
FT   CDS_pept        complement(95898..96599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0096"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0083 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34318"
FT                   /db_xref="GOA:E6UYY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34318.1"
FT                   /translation="MLIVRDLNTYYGNSHILRGVHAGIPTATSVGLLGRNGMGKTTLIR
FT                   SMMGYVRPASGEVQVDGRTVTGWPPEKMARLGIGYVPEGRGIFPNLSVRENLVMSERAG
FT                   IDGRRAWTFDRVMATFPRLAERLSHGGQQLSGGEQQMLSIGRALMTNPRLLILDEATEG
FT                   LAPLIVAEIWRVIGEIRSTGIATLIVDRDYRKVLAHTDLAVVMEKGQIVRHGASADLLA
FT                   EPQALEELLGV"
     atgctgatcg tccgcgacct caacacctac tacggcaaca gccacatcct gcgcggcgtg        60
     catgccggca ttccgacggc cacttcggtg ggcctgctcg ggcgcaacgg catgggcaag       120
     accacgttga tccgcagcat gatgggctac gtgcgcccgg cttcgggcga agtgcaggtc       180
     gatggccgca ccgtcaccgg atggccgccc gagaagatgg cgcgccttgg catcggctac       240
     gtgcccgagg gccgcggcat ctttccgaat ctctcggtgc gcgagaacct cgtgatgagc       300
     gagcgcgcgg gcatcgacgg ccgccgcgcc tggactttcg accgcgtgat ggccaccttc       360
     ccccggctcg ccgagcggct ctcgcacggt gggcagcagc tctcgggcgg cgagcagcag       420
     atgctttcca tcggccgcgc gctgatgacc aacccgcgct tgctgatcct cgacgaagcg       480
     accgaaggcc tcgcaccgct gatcgtggcc gagatctggc gcgtgatcgg cgagatccgc       540
     agcaccggca tcgccacgct gatcgtggac cgcgactacc gcaaggtgct cgcgcacacc       600
     gacctcgcgg tggtgatgga aaaggggcag atcgtgcggc acggggcgtc cgccgatctg       660
     ctcgcggagc cgcaggcgct ggaggaattg ctgggcgtct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page