(data stored in SCRATCH zone)

EMBL: CP002417.PE96

CP002417.PE96        Location/Qualifiers
FT   CDS_pept        complement(96599..97345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0097"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0084 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34319"
FT                   /db_xref="GOA:E6UYZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34319.1"
FT                   /translation="MNALLSVEGLTRRFGGLTAVNAVTLDLHVGEVHAVIGTNGAGKST
FT                   LINMLSGEIEASEGRIALDGIDITQRAQSRRARDGVGRSYQRTTIFPEFSVHENCRLAA
FT                   QAATARPWAIWQASQRCAASNAAADSALEAAGLSNESLRIAGALSHGAQRQLEVAMCLA
FT                   TNPRVLLLDEPLAGMGAEETDRMLTLLARLKATHAILLVEHDMDAVFRIADRITVMVNG
FT                   TVIATGDPTSIRENPEVRTAYLGEDH"
     atgaacgcac tgctttccgt cgaaggcctc acccgccgct tcggcggcct caccgccgtg        60
     aacgccgtca cgctcgacct gcacgtcggc gaagtgcatg cggtgatcgg caccaacggc       120
     gcgggcaagt ccacgctcat caacatgctc tcgggcgaga tcgaggcctc cgaaggccgc       180
     attgcgctcg acggcatcga catcacgcag cgcgcgcaat cgaggcgcgc gcgcgacggc       240
     gtgggccgca gctaccagcg cacgacgatc tttccggagt tcagcgtgca cgaaaactgc       300
     cggcttgccg cgcaggccgc gaccgcgcgg ccttgggcga tctggcaggc gtcgcagcgc       360
     tgtgcggcga gcaatgcggc cgccgactcg gcgctcgaag ccgcgggcct ttcgaacgaa       420
     tccttgcgca ttgcgggcgc gctgagccac ggtgcgcagc gccagctcga agtggcaatg       480
     tgcctcgcga cgaatccgcg cgtactgctg ctcgacgaac cgctcgcggg catgggcgcc       540
     gaggaaaccg accgcatgct cacgctgctc gcgcggctga aggccacgca cgcgatcctg       600
     ctggtggagc acgacatgga tgcggtcttc cgcatcgccg accgcatcac ggtgatggtg       660
     aacggcacgg tcatcgccac tggcgacccg acatcgattc gcgagaaccc cgaagtgcgc       720
     accgcctacc tcggagaaga ccactga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page