(data stored in SCRATCH zone)

EMBL: CP002417.PE97

CP002417.PE97        Location/Qualifiers
FT   CDS_pept        complement(97470..98423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0098"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0085 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34320"
FT                   /db_xref="GOA:E6UYZ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34320.1"
FT                   /translation="MMKKGAFLVPLACALLIGIAGPLMGNYASDFVVKVMILSIFALSL
FT                   ELLVGMTGLVSLGHAAFYGIGAYVTVLASGSEGGNFALLLPMAVGAAALYALFVGALSL
FT                   RTRGVYFIMVTLAFAQMAFFVFHDTKVGGGSDGIYMYVRPAIGALDLENRTVLFYVVLA
FT                   SLVFTYGLLALIRRSRFGAALAGIRVNEQRMRAAGFPVYGYKLAAFVLAGALAGLAGFL
FT                   LASRDGVVNPELMAWHNSGEVLLMVILGGLGHLRGAVIGAIAFTLLKEIFSTHAVMGPL
FT                   ADHWQLTLGIAIIVFVAWLPKGLIGLVNRISPKEAA"
     atgatgaaga agggtgcatt cctcgtgccc ctggcctgcg cgctgctcat cggcatcgcc        60
     ggcccgttga tgggcaacta cgcctcggac ttcgtcgtga aggtgatgat cctgtcgatc       120
     ttcgcgctga gcctcgaact gctggtcggc atgaccggcc tcgtgagcct gggccatgcg       180
     gcgttctacg gcatcggcgc ctacgtgacg gtgctcgcat cgggcagcga aggcggcaac       240
     ttcgcactgc tgctgccgat ggccgtgggc gcggcggcgc tctatgcgct gttcgtcggc       300
     gccttgagcc tgcgcacgcg cggcgtgtac ttcatcatgg tcacgctggc cttcgcgcag       360
     atggccttct tcgtgttcca cgacaccaag gtcggcggcg gcagcgacgg catctacatg       420
     tacgtgcggc ccgccatcgg cgcgctcgac ctggagaacc gcacggtgct gttctacgtg       480
     gtgcttgcat cgttggtgtt cacctacggg ctgctcgcgc tgattcgccg ctcgcgcttc       540
     ggcgccgcac tcgcgggcat tcgcgtgaac gagcagcgca tgcgcgcggc gggcttcccc       600
     gtgtacggct acaagctcgc ggccttcgtg ctggcgggtg cgctcgcggg gctcgcgggt       660
     ttcctgctgg cctcgcgcga cggggtggtc aatcccgagt tgatggcctg gcacaactcg       720
     ggcgaggtgc tgctgatggt gatcctcggt ggcctcggcc acctgcgcgg cgcggtgatc       780
     ggcgcgatcg cgttcacgct cttgaaggaa atcttctcga cgcacgccgt gatgggaccg       840
     ctcgcggacc actggcagct cacgctgggc atcgcgatca tcgtgttcgt ggcgtggctg       900
     ccgaaggggt tgatcgggtt ggtgaatcgc atctcgccga aggaggccgc atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page