(data stored in SCRATCH zone)

EMBL: CP002505.PE104

CP002505.PE104       Location/Qualifiers
FT   CDS_pept        complement(112933..115422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0105"
FT                   /product="Cellulose synthase BcsB"
FT                   /note="PFAM: Cellulose synthase BcsB; KEGG: ebi:EbC_44010
FT                   cellulose synthase operon protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71737"
FT                   /db_xref="GOA:A0A0H3F4Q2"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q2"
FT                   /inference="protein motif:PFAM:PF03170"
FT                   /protein_id="ADW71737.1"
FT                   /translation="MNRPYNLMSKRRLLAARGTSLFRKITTGLLLTFSSLPLSQAEDAP
FT                   APAVDPATSLPAAPSWLPPVMPMPGETAPAGDTTPAPAADAPQTDTTPVNNSPAMPDVT
FT                   ADPSAAPAPVMPLVQPVTSNVTVAEMGQPNGLTLSGGQLQSGIIFTLPADEVVTNAHLS
FT                   LALKISPALIARDTTLELMLNGQPLGNLPLNQSSNGGDVYDLDIPAAMVVSNNNLSFRV
FT                   HDSNTMTCEKDQSDKYWVTILPTTSIGLEGQQLNIGRNLGNFPRPFFDGLQMQESKITM
FT                   GFSAAMKPGDISAAAMVSSYLGMLSDYRSVDFPVILNDLPDQNGILFGKPGDKIGSLTL
FT                   PASNGASIQIIDNPINPVYKLLLVLGNDDNQLRQAAYRLISGGMPNNTDHLDVAQQTIP
FT                   SSKPYDAPRWIDTSRPVTLGELAGKDQDSLISNGIYHDGIQVAFRAAPDLFMWDGHNIP
FT                   VRIDYRFPTENWIDEDSSRLNVSINSNFLRSLTVNKVGLVENIWRRLGGDSRQERYTLQ
FT                   LAPYLIYGDNQLQFYFDIKPKKDAPCSILTSDNIKSRIDPKSFIDLSGSYHFAQLPNLS
FT                   YFVGASYPYSKLADFSDTLMLLPQTPTADEIHTLLNLASRAGKATGMPVNHVQVAFGLN
FT                   GDEQNNPLFDRDILAVTTLGDTPFNQQLLADSPFSINGGSMGVKTPTEMQRVVAWLTGD
FT                   WYRQPVDADRYLSSTGAWRGFVSYRSRWSADHVVVLATGTDDQQLLKIHNDLKSPKINA
FT                   NVRGDLAIITDENGIRSFSVGQQFPTGQMPWYMMVLWYASKHIVILSLIATLLSLVVGL
FT                   SLFVVLRRHAAKRLGQK"
     atgaaccgac cttataacct catgagtaag cgccgtttat tggctgcgcg gggcacatcc        60
     ctgttcagaa aaatcaccac cggtttgttg ttgacgttca gcagtctgcc gttgtcacag       120
     gcggaagacg cgccggcacc agccgttgat ccggcaacca gcctgccagc cgcgccgtca       180
     tggctaccgc cggtcatgcc gatgccgggt gaaacggcgc cagccggtga cacaacgcca       240
     gccccggccg cagatgcacc acagacggat accacgccgg tgaataacag cccggcgatg       300
     cctgatgtaa ctgccgatcc ttccgctgcc cctgcgccgg taatgccgct ggttcagccg       360
     gtgaccagca acgtcaccgt tgccgaaatg ggccagccga acgggctgac gctcagcggc       420
     ggccagttgc agtccggtat cattttcacc ctgcctgccg atgaagtagt gaccaacgcg       480
     cacctgtcgc tggcactgaa aatttctccg gcgctgattg cccgcgatac cacactcgaa       540
     ctgatgctca acggccagcc gctgggtaac ctgccgctga atcagagcag caacggcggc       600
     gatgtttacg atctcgatat tccggcagcc atggtggtat ccaacaacaa cctgagcttc       660
     cgcgtgcatg acagcaacac catgacctgc gagaaagatc agtcggataa atattgggtc       720
     actattttgc ccaccaccag catcgggctg gaaggtcagc aactgaatat tggccgtaat       780
     ctgggtaact tcccgcgtcc attctttgat ggcctgcaga tgcaggagtc caaaatcacc       840
     atgggcttct ctgctgccat gaaaccgggc gatatcagcg ctgcggcgat ggtctcttct       900
     tatctcggca tgttgtccga ttatcgcagc gtcgatttcc cggtcatcct gaatgatttg       960
     ccggatcaga atggcattct gttcggcaag ccgggggata aaatcggttc actgacgttg      1020
     ccggcgagca acggcgcatc gattcagatt atcgataacc cgatcaatcc ggtttacaag      1080
     ctgctgctgg tactcggtaa tgacgataac caactgcgtc aggctgcgta tcgcctgatc      1140
     agtggcggga tgccgaacaa caccgaccat ctggatgtgg cccagcaaac cattccgtcc      1200
     agcaaaccgt atgacgcgcc gcgctggatt gacacctcac ggccggtgac gctgggtgaa      1260
     ctggcgggta aagatcaaga ttcgctgatt tcaaacggca tttatcacga cggcattcag      1320
     gtcgccttcc gcgctgcgcc agatctgttc atgtgggatg gacacaatat tccggtgcgc      1380
     attgattacc gtttccccac cgaaaactgg attgatgaag acagttcaag actcaacgtc      1440
     tccatcaaca gcaacttcct gcgcagcctg accgtcaaca aagtgggtct ggtggaaaat      1500
     atctggcgtc gcctgggcgg tgacagccgt caggaacgct acacgctgca actcgcgccc      1560
     tacctgattt acggcgacaa ccagttgcaa ttctatttcg acatcaagcc gaaaaaagat      1620
     gcgccgtgca gcattctgac cagcgacaat attaagagcc gtatcgatcc aaaatctttc      1680
     atcgacctga gcggaagcta ccacttcgcc cagttgccga acctgtcgta tttcgtcggc      1740
     gcgtcttatc cgtactccaa actggctgat ttctccgaca ccctgatgct gttgccgcaa      1800
     acgccgacag cggatgaaat ccacaccctg ctgaacctgg cctcacgcgc cggtaaagcc      1860
     acaggcatgc cggtgaatca tgtgcaggtg gccttcggcc tgaacggtga tgaacaaaat      1920
     aacccgctgt ttgaccgcga tattctggcc gtcaccacgc tgggcgacac gccattcaac      1980
     cagcagttac ttgcggactc tcctttcagc atcaacggtg gctcaatggg cgtaaaaacg      2040
     ccgaccgaaa tgcagcgcgt tgtcgcctgg ctgaccggtg actggtaccg ccagccggtc      2100
     gatgcagacc gttatctgtc ctcaaccggc gcatggcgtg gcttcgtcag ctaccgttcg      2160
     cgctggtctg ccgaccatgt ggtcgtgctg gcaaccggta cagacgatca gcagttgctg      2220
     aaaatccata acgatttgaa atcacccaaa atcaacgcca acgtgcgcgg cgatctggcg      2280
     attattaccg atgaaaatgg catccgcagc ttctcagtgg gtcagcaatt cccgaccggg      2340
     caaatgccgt ggtacatgat ggtgctctgg tatgccagca aacacatcgt gatcctgtcg      2400
     ttgattgcga ccctgctttc gctggtggtt ggcctgagcc tgttcgttgt cctgcgtcgt      2460
     cacgcggcca aacgtctggg tcagaaatga                                       2490
//

If you have problems or comments...

PBIL Back to PBIL home page