(data stored in SCRATCH zone)

EMBL: CP002505.PE116

CP002505.PE116       Location/Qualifiers
FT   CDS_pept        complement(130770..132092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0117"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); KEGG: spe:Spro_4745 major facilitator
FT                   superfamily metabolite/H(+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71749"
FT                   /db_xref="GOA:A0A0H3F751"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F751"
FT                   /inference="protein motif:TFAM:TIGR00883"
FT                   /protein_id="ADW71749.1"
FT                   /translation="MQATITPELEADAQLVSQNSRSKVIVASLIGTAIEFFDFYIYATA
FT                   AVIVFPHIFFPQGDPTAATLQSLATFAIAFVARPIGSALFGHFGDRVGRKVTLVASLLT
FT                   MGVSTVVIGLLPTYATIGVFAPMLLALARFGQGLGLGGEWGGAALLATENAPAKKRALY
FT                   GSFPQLGAPIGFFFANGMFLLLSWLLTDEQFISWGWRVPFLLSAVLVIVGLYVRVSLHE
FT                   TPVFAKIAKAGKQVKVPIGTLFTKYKKATILGTFIMVATYTLFYIMTVYSLGYGTAAKP
FT                   VGLGIPRNEFLLMLMIGVVGFGVMVPVAGQLADKFGRRKTMICITLLMIVFALCFPTIL
FT                   GAGSQALVMVFLLCGFMVMGLTFGPMGALLPELFPTEVRYTGASFSYNVSSILGASVAP
FT                   YIATWLATHYGLFYVGVYLASMATLTLIALLLSKETAHQSL"
     atgcaagcca ctatcactcc agaattagaa gctgacgcgc aattggtgag tcagaactcc        60
     cgcagcaaag tcatcgtggc atcgcttatc ggtacggcca ttgaattctt cgacttttat       120
     atctatgcca ctgctgcggt gattgttttc ccgcacattt tcttcccgca gggtgacccg       180
     acggcggcca cgctacagtc tctcgcgacc tttgccatcg cctttgtcgc caggccgatc       240
     ggttccgcgc tgttcggcca cttcggcgac cgcgtcggac gtaaagtcac gctggtggcc       300
     tctttgctga cgatgggcgt gtctaccgtg gtgatcggcc tgctgccgac ctacgcaacc       360
     attggcgtct tcgcaccgat gctgctggcg ctggcgcgtt ttggtcaggg tctgggactg       420
     ggcggtgaat ggggtggcgc ggcgctgctc gccaccgaga acgcaccggc gaagaaacgc       480
     gccctgtacg gttctttccc gcagcttggc gcaccgattg gcttcttctt cgcgaacggc       540
     atgttcctgc tgctgtcgtg gctgctgacc gacgaacagt ttatttcctg gggctggcgt       600
     gtgccgttcc tgctttctgc ggtactggtg atcgtcggtc tgtatgtgcg cgtttccctg       660
     cacgaaacac cggtatttgc caaaattgcc aaagccggta aacaggtgaa agtgccaatc       720
     ggcacgctgt tcactaaata taaaaaggcg acgattctcg gcacctttat catggttgcg       780
     acttacacgc tgttctacat catgaccgtg tattcactgg gttacggcac tgccgcaaag       840
     ccggtcgggc tgggcattcc gcgcaatgaa ttcctgctga tgctgatgat cggcgtggtc       900
     ggtttcggcg tgatggtgcc ggttgccggt cagctggcgg ataagtttgg ccgtcgcaaa       960
     accatgattt gtattacgct gctgatgatc gtcttcgccc tgtgtttccc gaccattctg      1020
     ggtgccggtt cacaggcgct ggtgatggta ttcctgctgt gtggtttcat ggtgatgggg      1080
     ctgactttcg gtccgatggg tgcgctgctg ccggagctgt tcccgacaga agttcgctat      1140
     accggcgcgt ccttctccta taatgtgtct tcgatactag gcgcatctgt cgcgccgtac      1200
     atcgccacct ggctggcaac ccattacggg ttgttctatg tgggcgttta tctggcctca      1260
     atggcaacgc tgacgctgat cgcgctgctg ctgtccaaag aaaccgccca tcagtcattg      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page