(data stored in SCRATCH zone)

EMBL: CP002505.PE12

CP002505.PE12        Location/Qualifiers
FT   CDS_pept        complement(11516..12766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0012"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ypi:YpsIP31758_4140 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71645"
FT                   /db_xref="GOA:A0A0H3F3B7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3B7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADW71645.1"
FT                   /translation="MTFSAFGDKFTRFSGITRLMGDMNDGLRTPGAVMLGGGNPAQIPE
FT                   MQDYFQTLLSEMLAAGKLTEALCNYDGPQGKDVLRHALADMLQKELGWQLDAQNIALTN
FT                   GSQSAFFYLFNLFAGRRADGSMSKVLFPLAPEYLGYADAGLDENLFVSAKPNIELLPEG
FT                   QFKYHVDFDHLNITDDIGLICVSRPTNPTGNVITDEELIRLDALAQQKDIPLLIDNAYG
FT                   VPFPGIVFTDATPLWNPNIILCMSLSKLGLPGSRCGIVIADEKIIKAISNMNGIISLSP
FT                   GSVGPAIAHEMIVRGDLLRLSEEVIKPFYFQRVQETIATLRRYLPEERCLIHKPEGAIF
FT                   LWLWFKDLPITTEVLYQRLKQRGVLMVPGDYFFPGLEHPWPHTHQCMRMNYVPDAEQIE
FT                   RGVKILAEEVEKAHAEG"
     atgacgtttt ctgctttcgg tgacaaattt acccgttttt caggcatcac acgcctgatg        60
     ggcgacatga atgacggttt acgcacgcct ggcgcggtga tgctcggcgg cggtaatccg       120
     gcgcaaattc ctgagatgca ggattatttc cagacgctgc tgtcggaaat gctggccgca       180
     ggcaagctga ccgaagcgct gtgcaattac gacgggccgc agggcaaaga tgtgttgcgt       240
     catgcgctgg cagacatgtt acagaaagaa ctcggctggc agcttgacgc gcaaaacatc       300
     gcactgacca acggcagcca gagcgccttc ttctatttgt tcaacctgtt cgccggacgc       360
     cgtgccgacg gtagtatgtc aaaagtgttg ttcccgctgg caccggaata tctcggttat       420
     gcagatgccg gtctggacga aaatctgttt gtttcagcca agccgaacat cgaattactg       480
     ccggaaggcc agttcaaata tcacgtcgat ttcgatcatc tgaatatcac cgatgatatc       540
     ggcctgatct gcgtgtcacg cccgaccaac ccgaccggta acgtcattac tgacgaagaa       600
     ctgatccgcc tcgatgcgct ggcacagcag aaagatattc cgttattaat cgacaacgcg       660
     tatggcgtgc cgttcccggg catcgtattc actgacgcca caccgctgtg gaatccgaat       720
     attatcctgt gcatgagctt gtcgaaactc ggcctgccgg gttcacgctg tggcatcgtg       780
     attgctgatg agaaaatcat caaagcgatc agtaatatga acgggattat cagcctgtcg       840
     ccgggtagtg tcggcccagc gattgcccat gaaatgattg tccgtggcga tttgctgcgc       900
     ctttccgaag aagtgatcaa accgttctat ttccagcgcg tgcaggaaac tatcgccacg       960
     ctgcgccgtt atctgccgga agaacgttgc ctgatccaca aaccggaagg ggcgattttc      1020
     ctgtggctgt ggttcaagga tttaccgatc accaccgaag tgctgtatca gcgcctgaaa      1080
     caacgtgggg tacttatggt gccgggcgat tacttcttcc cgggtctcga gcatccgtgg      1140
     ccacatacgc atcagtgcat gcggatgaat tacgtgcctg atgcggaaca gatcgagcgc      1200
     ggcgtgaaaa ttctggcaga agaagtagaa aaagcccacg ctgaaggctg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page