(data stored in SCRATCH zone)

EMBL: CP002505.PE121

CP002505.PE121       Location/Qualifiers
FT   CDS_pept        136455..137033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0122"
FT                   /product="cytochrome B561"
FT                   /note="KEGG: pam:PANA_1606 YceJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71754"
FT                   /db_xref="GOA:A0A0H3F756"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F756"
FT                   /inference="similar to AA sequence:KEGG:PANA_1606"
FT                   /protein_id="ADW71754.1"
FT                   /translation="MQTSSSVLRSRYDGLTILLHWLTALAVIFLFASAHIWEVLERGTP
FT                   LRKGLQSVHISVGILLAAIIIGRLLWRLFTVSTGRSKQQPVAMPTLMKAAAHLTHLALY
FT                   LLLVAQIILGFLFRWSQAEPFYFFGLFPIPDVFNFDSVMTRTFGSLHNNVAWALIIIAG
FT                   IHALAALFHHYVLRDGILRRMLPGSTSRP"
     atgcaaactt catcttctgt tcttcgcagc cgttacgacg gcctgactat tttgctgcac        60
     tggctgacgg ccctggccgt catcttcctg tttgccagcg cgcatatctg ggaagtgctg       120
     gagcgcggca cgccgctgcg caaagggctg caatcggtgc atatctcggt ggggatactg       180
     ctggcggcga ttattatcgg gcgtctttta tggcgtttgt ttaccgtcag caccggtcgc       240
     agtaaacagc aaccggtcgc catgccgacg ctgatgaaag ccgccgcgca cctgacccat       300
     ctggcgctct atctattgct ggtcgcgcaa atcattctgg gctttttatt ccgctggtcg       360
     caggccgaac cgttctactt cttcggttta ttccccattc ctgacgtgtt caatttcgac       420
     agtgtgatga ccagaacttt cggttcgttg cacaacaacg ttgcctgggc gctgatcatt       480
     attgcgggta tacatgcgct ggcggcactg ttccaccatt acgttctccg cgacggcatt       540
     ttgcgccgca tgttaccggg cagcacaagc cgcccgtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page