(data stored in SCRATCH zone)

EMBL: CP002505.PE127

CP002505.PE127       Location/Qualifiers
FT   CDS_pept        142868..143920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0129"
FT                   /product="ImpA domain-containing protein"
FT                   /note="KEGG: ent:Ent638_2910 ImpA domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Q0"
FT                   /inference="similar to AA sequence:KEGG:Ent638_2910"
FT                   /protein_id="ADW71760.1"
FT                   /translation="MGILHPQECYFLENFISAEHYAETRDAIIAYIDAHEEALARYKRE
FT                   MPINTRKLPQWQQADIVWESRVMSNIRPLKERYIKAYILRTHNDVKAFDIGHAMSNINK
FT                   GIVEFWDGWMTDQEKDKIRHHEYQASELDKNLSITIWGEWEEGRLTYSDNCVRPYIKIP
FT                   KKIPLYILDSSVRIEKGDVPIQTGIYLPDVDFSAARFLPADYGESPDARQGIQRNEWFD
FT                   AETCKHRFSWKESKWAKTGWTLIRRVEGEFIDVPPEGFFPKGLPEELYNWPEKEKLLRQ
FT                   VEPVRLTAYSGETSPHSGRWGTFIDGSLRYAHVKQGQALPEYEDKESKLHRTLWSLLER
FT                   DDKGSVFINS"
     atggggattt tacatccgca ggaatgttat tttttagaaa attttatctc agcagaacat        60
     tatgccgaaa cccgtgacgc catcattgcc tatatcgatg cccatgaaga agccctggca       120
     agatataaac gtgaaatgcc gattaatacc cgtaagctcc cccaatggca gcaggctgat       180
     atagtatggg aatcacgcgt aatgtctaat atccgaccat taaaggaacg ttatatcaag       240
     gcttacattc tgcgaactca taatgatgtt aaggcatttg atattggtca tgctatgagc       300
     aatatcaata agggaatcgt agagttttgg gatgggtgga tgactgatca agaaaaagat       360
     aaaattagac atcatgagta tcaagcttca gaactagata aaaacttatc aataacaata       420
     tggggagagt gggaggaggg gcgtttgaca tatagtgata attgtgtgcg cccatatata       480
     aaaattccaa aaaaaattcc tctttatata cttgactcat ccgtgagaat agaaaaagga       540
     gatgtaccaa tccaaactgg aatatattta cctgatgttg atttttcggc agctcgattt       600
     ttaccagctg attatggtga atcacctgat gcacggcagg gcattcagcg taacgaatgg       660
     tttgacgcag aaacttgtaa acatagattc agttggaaag agtctaagtg ggcaaaaaca       720
     ggctggaccc ttatccgtcg ggttgaaggc gaatttatcg atgtgccgcc ggaaggtttt       780
     ttcccgaaag gattaccgga ggaattgtac aactggccgg agaaagagaa gttattacgc       840
     caggtggaac ccgtccgact tactgcatac agcggcgaaa ccagcccgca ctcgggccgc       900
     tggggcacct ttatcgacgg cagtttgcgt tatgctcatg tcaaacaagg ccaagccctg       960
     ccggaatatg aagataaaga aagcaagctt caccgtacgc tttggtcact gctggagcgg      1020
     gatgataagg gcagcgtttt tataaacagc taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page