(data stored in SCRATCH zone)

EMBL: CP002505.PE151

CP002505.PE151       Location/Qualifiers
FT   CDS_pept        complement(175149..175331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0154"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   ara:Arad_4160 4-oxalocrotonate tautomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71784"
FT                   /db_xref="GOA:A0A0H3F778"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F778"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ADW71784.1"
FT                   /translation="MPMIRLEMFPGRTPEQKRDFVREVTRLAAETLKCKPESVDVVITE
FT                   IPKSHWAKGGVLPEE"
     atgccgatga tccgtctgga aatgtttcct ggccgtaccc ccgaacaaaa acgtgacttt        60
     gtccgcgaag tgacccgcct ggcagcagaa accctgaaat gtaaacctga aagtgtggat       120
     gtggtgatca ctgaaatacc gaaatcacat tgggcaaaag ggggagtgtt gccggaagaa       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page