(data stored in SCRATCH zone)

EMBL: CP002505.PE155

CP002505.PE155       Location/Qualifiers
FT   CDS_pept        complement(177483..177926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0158"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: ebi:EbC_37870 PTS
FT                   system, mannitol-specific EIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71788"
FT                   /db_xref="GOA:A0A0H3F4H5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H5"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADW71788.1"
FT                   /translation="MLSDWINENNTQIISKIDDWKSAVAFAVQPLIDSGAAESRYLQAI
FT                   YDMHREIGPYYVLGEGIAMPHARPEEGVNRTALSLVIVSEGVEFGSEDNDPVYVIFALA
FT                   AVDSHSHIEMIASLSHLFCDDEAAERLKRSKNKQEALEIIRQF"
     atgttaagcg actggattaa tgaaaataac acgcaaatca ttagcaaaat agatgactgg        60
     aaaagtgccg tggcatttgc cgtgcaacca ttaattgatt cgggcgcagc ggaaagtcgt       120
     tatcttcagg ctatatatga tatgcaccgg gaaatcgggc cttattatgt tttgggcgaa       180
     ggtattgcga tgccgcacgc ccggccggaa gaaggggtta accgaacggc actgtctttg       240
     gtcattgttt cagaaggcgt tgagtttggc agtgaagata atgatccggt ttacgttatc       300
     ttcgcgctgg ccgcggtgga cagccattca cacatcgaaa tgattgccag cctttcccat       360
     ctgttctgcg atgacgaggc agcggaacga ttaaaacgca gtaaaaacaa gcaggaagca       420
     ttagagatta tccgacagtt ttag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page