(data stored in SCRATCH zone)

EMBL: CP002505.PE173

CP002505.PE173       Location/Qualifiers
FT   CDS_pept        complement(196995..197435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0176"
FT                   /product="UspA domain-containing protein"
FT                   /note="PFAM: UspA domain-containing protein; KEGG:
FT                   spe:Spro_4691 UspA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71806"
FT                   /db_xref="GOA:A0A0H3F9J4"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9J4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADW71806.1"
FT                   /translation="MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYSD
FT                   LYTGLIDVNLGDMQKRISEETHHALNELSQNAGYPISETLSGSGDLAQVLVDAINKYGM
FT                   DLVLCGHHQDFWSKLMSSARQLINTVHIDMLIVPLRDEEEEE"
     atggcttaca aacacatact tattgctgtg gacttgtcac cggagagcaa agttctggtc        60
     gagaaagccg tttccatggc gcgtccgtat aacgccaaag tgtccctgat ccacgttgat       120
     gtaaactatt ccgacctgta taccggtctg atcgacgtta atctgggtga catgcagaaa       180
     cgtatttccg aagaaacgca tcacgcgttg aacgaactgt cgcaaaatgc cggctatccg       240
     atttcagaaa ccctgagcgg cagcggtgat ttagcgcagg tgctggtgga tgccatcaac       300
     aaatatggca tggacttagt actgtgcggc catcaccagg atttctggag caaactgatg       360
     tcctccgcac gccagctaat caacaccgtt catatcgaca tgctgatcgt gccgttgcgc       420
     gatgaggaag aagaagaata a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page