(data stored in SCRATCH zone)

EMBL: CP002505.PE175

CP002505.PE175       Location/Qualifiers
FT   CDS_pept        complement(198209..199714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0178"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: spe:Spro_4689
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71808"
FT                   /db_xref="GOA:A0A0H3F4I8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I8"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADW71808.1"
FT                   /translation="MLHLFAGLDIHTGSLLILALLFVLFYEAINGFHDTANAVATVIYT
FT                   RAMRSQLAVVMAGVFNFFGVLLGGLSVAYAIVHLLPTDLLLNVGSAHGLAMVFSMLLAA
FT                   IIWNLGTWYFGLPASSSHTLIGAIIGVGLTNALMTHTSVVDALNIPKMIGIFASLIISP
FT                   LVGMIIAGTMIFLLRRYWSGNKKHARIHLTPAEREKKDGKKKPPFWTRTGLILSAIGVS
FT                   FSHGANDGQKGIGLIMLVLIGVAPAGFVVNMNATGYDITRTRDAVTHLGQYYQQHVDAV
FT                   PHVVAQTPIVPAPDVNIAPTDEPKVFHCDSSHALDAIGRAQTLLTNLQSYSDLAPEERS
FT                   HMRRLLMCVSDTADKVAKLPETSPADKRFLGELKTDILQTVEYAPIWIIIAVALALALG
FT                   TMIGWKRVATTIGEKIGKKGMTYAQGLSAQLTAAVSIGVASYTGMPVSTTHVLSSAVAG
FT                   TMIVDGGGVQSKTVKNIAMAWVLTLPVSIVLSGVLYWIALKLI"
     atgctgcatc tatttgccgg attggatatt cataccggtt cgttattgat tctcgcgtta        60
     ctgtttgttc tgttctatga agccattaac ggctttcatg atacggccaa cgcagtggca       120
     accgtcatct atacccgggc aatgcgttcg caattagcgg tcgtgatggc aggggtattt       180
     aacttctttg gcgtcctgct cggtggtttg agtgtggcct atgccatcgt tcatttactg       240
     ccaaccgatt tgctgctcaa tgtgggttct gctcatggcc ttgccatggt gttctctatg       300
     ttactggccg cgatcatctg gaacctcggt acctggtatt tcggcctgcc ggcgtccagc       360
     tcccacaccc ttatcggcgc catcattggc gtagggctga ccaatgcatt aatgactcac       420
     acttccgtgg tcgatgcgtt aaacatccct aaaatgattg gtatttttgc ttcgctgatt       480
     atctctccgc tggtcgggat gattatcgcc ggtaccatga ttttcctgct gcgccgttac       540
     tggagtggca ataagaaaca tgcccgtatc cacctgacac cggcggaacg tgagaagaaa       600
     gacggcaaga aaaaaccgcc attctggaca cgtacaggtc tgattctgtc ggctatcggc       660
     gtgagtttct ctcacggcgc taacgatggt cagaagggta tcggtctgat catgctggtg       720
     ctgattggcg tggcgccagc cggttttgtg gtgaatatga acgcgaccgg ttacgacatt       780
     acccgtaccc gcgacgccgt gacacacctc ggccagtatt atcagcaaca tgttgatgcc       840
     gtgccgcacg tggttgcaca gacgccaata gtgccggcac cggacgtcaa tatcgcaccg       900
     accgatgagc ctaaagtgtt ccactgcgac agcagccacg cacttgacgc tatcggccgc       960
     gcgcaaaccc tgctgaccaa tcttcagtct tacagcgacc tggcaccgga agaacgcagc      1020
     catatgcgtc gcctgctgat gtgtgtttct gatactgcgg ataaagtggc caagctgccg      1080
     gaaacctctc ctgcagacaa acgcttcctc ggcgagctga aaacagacat tctgcaaacc      1140
     gttgaatacg cgcctatctg gatcattatc gctgtggcac tggcactggc gctgggtacg      1200
     atgattggct ggaaacgtgt cgcaaccact atcggtgaga agattggtaa gaaaggcatg      1260
     acttacgcac agggtctgtc tgcacagctc acggcggcgg tctccatcgg cgtagccagc      1320
     tataccggca tgccggtatc caccacgcac gtgctgtctt ctgcggtcgc aggaaccatg      1380
     attgtcgatg gtggcggtgt gcagtcgaaa accgtgaaaa acatcgcgat ggcgtgggtc      1440
     ttaaccctgc ctgtgtcgat tgtgctctcc ggtgtcctgt actggattgc actgaagctg      1500
     atctga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page