(data stored in SCRATCH zone)

EMBL: CP002505.PE183

CP002505.PE183       Location/Qualifiers
FT   CDS_pept        complement(208150..208659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0186"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spe:Spro_4654 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71816"
FT                   /db_xref="GOA:A0A0H3F9K3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9K3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71816.1"
FT                   /translation="MSEIVIRHAEAADAEALQHLYAQVPVYSDTLQLPYPPATLWEDRL
FT                   ANAAPGRFALVACIDGKLVGNLTLMVEQPWRRRHVATFGIGVDTQFQGKGVGSKLIAAA
FT                   LELCDKWLHVIRVELTVYADNDAAIGLYKKFGFSVEGLSPSYAMRDGELVDTLHMGRIR
FT                   GVRQPV"
     atgagcgaaa tagtcattcg tcacgctgaa gccgcagatg cagaggcgct tcaacaccta        60
     tacgctcagg ttcctgttta cagcgacacc ctgcaactcc cttatccacc cgccacgcta       120
     tgggaagacc gccttgccaa tgccgcaccc ggccggttcg cgctggttgc gtgtatcgac       180
     ggcaaactgg tgggcaatct caccctgatg gttgagcagc cgtggcgacg ccgccatgtg       240
     gcgactttcg gtattggtgt ggatacgcaa tttcagggaa aaggtgtcgg cagtaagctg       300
     atcgctgctg cccttgagtt gtgtgacaaa tggttgcacg tgatccgcgt cgagctgacg       360
     gtttatgccg ataatgatgc cgcaatcggg ctgtacaaaa agttcggttt cagcgttgaa       420
     ggcctcagcc cgagctacgc aatgcgcgac ggcgaactgg tggatacgct gcatatgggg       480
     cgcatccgtg gcgtacggca accggtttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page