(data stored in SCRATCH zone)

EMBL: CP002505.PE195

CP002505.PE195       Location/Qualifiers
FT   CDS_pept        224656..224988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu3981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71828"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K1"
FT                   /inference="similar to AA sequence:KEGG:plu3981"
FT                   /protein_id="ADW71828.1"
FT                   /translation="MSHMEYLEFIETPTFSRKCKELLTEEEYRQFQEYLTHYPDAGALI
FT                   VGTGGCRKIRWGHQRRGKSAGVRAIYYYLCADGQIFMLLVYPKSEKDSLTESEKLILKN
FT                   IVRSLS"
     atgagtcata tggaatatct ggagtttatc gaaaccccga cctttagccg caaatgcaaa        60
     gagctgctga ctgaggagga atatcgccag tttcaggaat acctcaccca ttatcccgac       120
     gcaggggctt tgattgtcgg cacaggtgga tgcagaaaaa tccgctgggg tcatcaaagg       180
     cgtggaaaaa gtgcgggtgt gcgggcgatt tattattacc tgtgcgctga cggtcagatt       240
     ttcatgctgc tggtttatcc gaagagtgag aaagattcac tgacggaaag cgaaaaattg       300
     attttgaaaa acattgtacg aagtctgtcg tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page