(data stored in SCRATCH zone)

EMBL: CP002505.PE197

CP002505.PE197       Location/Qualifiers
FT   CDS_pept        complement(225349..225942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0200"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: eca:ECA4157 putative dITP- and XTP-
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71830"
FT                   /db_xref="GOA:A0A0H3F3V9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3V9"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ADW71830.1"
FT                   /translation="MTEMISATILLFLIMDPLGNLPIFMSVLKHLDPKRRRVVLIREML
FT                   IALILMLIFLFAGEKILSFLNLRTETVSISGGIILFLIAIKMIFPSEEKSSSGLPAGEE
FT                   PFLVPMAIPLVAGPSILATLMLLSHQYPNQMSHLTLALFIAWGMSMAILLLSNLFLRLL
FT                   GDKGVSALERLMGLILVMLSTQMFLDGIRAYLKI"
     atgaccgaaa tgatttcagc aaccattttg ctgtttttaa ttatggatcc gctgggcaac        60
     ttaccgattt ttatgtcggt tttaaaacat ctcgacccga aacgtcgccg ggtcgtgtta       120
     atccgcgaaa tgctgatcgc actgatcctg atgctgattt tcctgttcgc cggggaaaaa       180
     atcctgtcgt tcctgaattt acgtaccgaa accgtgtcga tttccggcgg tattattctg       240
     ttcctgattg ctatcaaaat gattttcccg tcagaagaga aaagcagcag cggcctgcca       300
     gccggtgagg aacccttcct cgtaccgatg gccatcccgc tggttgctgg cccgtcgatt       360
     ctcgcgacgc tgatgctgct ttcgcaccag tatccgaatc agatgagtca tctcacgctg       420
     gcgctgttta tcgcctgggg catgtcgatg gcgatccttc tgctgtcgaa cttgttcctg       480
     cgcctgctcg gcgacaaagg cgtcagcgcc ctcgaacgcc tgatgggcct gattctggtg       540
     atgctctcaa cacagatgtt ccttgatggg atcagggcgt atctgaagat ttag             594
//

If you have problems or comments...

PBIL Back to PBIL home page