(data stored in SCRATCH zone)

EMBL: CP002505.PE201

CP002505.PE201       Location/Qualifiers
FT   CDS_pept        231894..233171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0204"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="KEGG: spe:Spro_4645 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71834"
FT                   /db_xref="GOA:A0A0H3F7C2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7C2"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADW71834.1"
FT                   /translation="MATLDNRDPVMLARQLPLKSVALILAGGRGSRLKDLTATRAKPAV
FT                   HFGGKFRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSFLNEEMNEFVDLLPA
FT                   QQRHSTEHWYKGTADAVYQNLDIIRRYNAEFVVILAGDHIYKMDYSRMLIDHVQKGGEC
FT                   TVACLEVPRTEASEFGVIGVTEDYHITSFVEKPKDPPPMPGNPDMALASMGIYIFNADY
FT                   LFRMLEEDMASEESSHDFGKDLIPKLTRQGVARAHPFGLSCVTQNDEAPPYWRDVGTLD
FT                   AYWRANLDLASVTPELDMYDRDWPIRTHMEPLPPAKFVQDRSGSHGMTMNSLVAGGVIV
FT                   SGSVVVHSVLFPRVRVNSFCNIDSAIILPDVNVGRSCRLRKCVIDRACQIPEGMVIGEN
FT                   ADEDSRRFYRSEGGVVLVTRAMLAKL"
     atggcgacat tagataaccg ggacccggtc atgctggcaa ggcagttgcc gctgaaatcc        60
     gtggcattaa tccttgccgg gggccgtggt tcaagactga aagatttaac cgcaacccgg       120
     gcaaaacccg ccgttcactt tggcggaaaa ttccgcatca ttgatttcgc cctgtcaaat       180
     tgcctgaact ccggcattcg tcgcatcggc gtgattacac aatatcagtc acacacgctg       240
     gttcagcata tccagcgcgg ctggtctttc cttaacgaag aaatgaacga attcgtggat       300
     ttacttccgg cgcagcaacg ccacagcacc gagcactggt acaaaggtac cgccgatgcg       360
     gtttatcaga atctggatat catccgccgc tataacgccg agtttgtggt gatcctggcg       420
     ggtgatcata tctacaagat ggactactcg cggatgctga tcgaccacgt gcagaagggc       480
     ggtgaatgta ccgtcgcctg cctggaagtg ccgcgcaccg aggccagtga attcggtgtt       540
     atcggcgtca ctgaggatta tcacatcacc agtttcgtcg aaaaacccaa agacccgccg       600
     ccgatgcccg gcaatcccga tatggcgctg gcgagcatgg gcatctacat ttttaatgca       660
     gactatctgt ttcgcatgct cgaagaagat atggcgagtg aagagtcgag ccacgatttc       720
     ggcaaagacc tgatcccgaa actgacccgt cagggcgtcg cccgcgcgca tccgtttggt       780
     ctttcctgcg tcacgcaaaa cgatgaagcg ccgccgtact ggcgtgatgt cggcacgctc       840
     gatgcctact ggcgcgctaa tctggatctg gcttctgtca cgccggaact ggatatgtac       900
     gaccgcgact ggccgatccg tacccacatg gagccgcttc cgcccgccaa atttgtacag       960
     gatcgctcag gcagccacgg catgaccatg aattcgctgg tggccggtgg cgtgattgtt      1020
     tccggttcgg tggtggtgca ttccgtgctg ttcccgcggg tacgcgtcaa ctctttctgc      1080
     aatatcgatt cggccatcat cctgccggat gtgaatgtgg ggcgttcatg ccgtctgcgc      1140
     aaatgcgtca ttgaccgcgc ttgtcagatc cctgaaggca tggtgattgg tgagaatgcc      1200
     gatgaagaca gccgccgttt ctaccgttcg gaaggtggcg tggtgctggt gacccgcgca      1260
     atgctggcga aactataa                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page