(data stored in SCRATCH zone)

EMBL: CP002505.PE204

CP002505.PE204       Location/Qualifiers
FT   CDS_pept        complement(237309..238820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0207"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="KEGG: spe:Spro_4642 glycerol-3-phosphate
FT                   dehydrogenase; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71837"
FT                   /db_xref="GOA:A0A0H3F4Y2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Y2"
FT                   /inference="protein motif:PRIAM:1.1.5.3"
FT                   /protein_id="ADW71837.1"
FT                   /translation="METKDLIVIGGGINGTGIAVDAAGRGLSVLLLEAQDLACATSSAS
FT                   SKLIHGGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIRAG
FT                   LFLYDHLGKRTSLPASKGLKFGSESVLKPELTKGFEYSDCWVDDARLVVVNAQEVEERG
FT                   GEVRTRTRVTRAWREDGMWMVEAEDIDTGKTFTWRAKGLVNATGPWVKHFFDDGLKLKS
FT                   PYGIRLIKGSHIVVPRAHNQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYHGDPKD
FT                   VKIDDKEIGYLLKVYNDHFKKQLTTEDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHD
FT                   QDGKAPLLSVFGGKLTTYRKLAEHALEKLVKYYPKAGPAWTKTAVLPGGKLNGDRDTYS
FT                   ANLRSRFKWLPESLARRYARTYGSQTELFLNDATSLESLGEDFGHGFYEAELRYLVEKE
FT                   WVSQLDDAIWRRTKLGMWLDKTQQQRVAEWLETHKQQKKHLSLAS"
     gtggaaacca aagacttgat cgtaattggt ggcggtatta atggtaccgg catcgcagtc        60
     gacgcagctg gccgcgggct gtctgttctg ctgcttgaag cgcaagactt ggcctgcgcg       120
     acctcttcgg ccagttctaa actgatccac ggtggcctgc gctatctgga acattacgaa       180
     ttccgtctgg tcagcgaagc gctggctgaa cgtgaagtgc tgttgaaaat ggcaccgcat       240
     attgctttcc cgatgcgttt ccgtttaccg catcagccgc atttgcgccc ggcctggatg       300
     atccgcgccg gtttgttcct gtacgaccat ctgggcaaac gcaccagcct gccggccagt       360
     aaaggtctga aattcggcag cgagtccgtg ctgaaaccag aactgaccaa aggttttgaa       420
     tactcggatt gctgggtcga cgatgcgcgt ttagtggtcg tcaatgcaca ggaagtggaa       480
     gaacgtggcg gcgaagttcg tacccgcacc cgcgtgaccc gcgcatggcg tgaggacggc       540
     atgtggatgg ttgaagccga agatatcgac accggcaaaa ccttcacctg gcgcgccaaa       600
     ggtctggtga acgctaccgg tccgtgggta aaacatttct tcgacgacgg cctgaagctg       660
     aaatcgccat acggcatccg tctgatcaaa ggcagccata ttgtggtgcc ccgtgcacac       720
     aatcagccgc aggcctacat tctgcaaaac gaagatcacc gcattgtttt cgtgatcccg       780
     tggatggatg aattctccat catcggcacc accgacgtgg aatatcacgg cgatccgaaa       840
     gacgtgaaaa tcgacgataa agaaatcggt tatctgctga aagtgtataa cgaccacttt       900
     aagaaacagc tgaccaccga agacatcgtc tggacttatt ccggcgtgcg cccgctgtgc       960
     gatgacgaat cagattcacc acaggcggtg acccgcgatt acacgctcga cgttcacgat      1020
     caggatggca aagcgccgct gctttctgta ttcggcggca agctgaccac ctaccgtaaa      1080
     ctggcagaac acgcgctgga aaaactggtg aagtactatc cgaaagccgg cccggcgtgg      1140
     accaaaacgg ccgtgctgcc tggcgggaaa ctgaacggag accgtgatac ctacagcgcc      1200
     aatctgcgtt cccgcttcaa atggttaccg gaatcactgg cacgccgtta tgcgcgtacg      1260
     tacggcagcc agacagagtt attcctgaat gacgcgacca gccttgaatc gctgggcgaa      1320
     gatttcggtc acggattcta cgaagctgaa ctgcgttatc tggtggaaaa agagtgggtt      1380
     tcacagcttg atgatgccat ctggcgtcgt accaaactcg gtatgtggct ggataaaacc      1440
     cagcaacaac gcgtcgccga gtggctggaa acgcacaaac agcagaagaa acatctgtcg      1500
     ctggcgtctt ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page