(data stored in SCRATCH zone)

EMBL: CP002505.PE218

CP002505.PE218       Location/Qualifiers
FT   CDS_pept        250563..251252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0221"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: sea:SeAg_B4666 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71851"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9P1"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADW71851.1"
FT                   /translation="MTDALKQRVFEANMALPAFGLVTFTWGNVSGIDRERGIVVIKPSG
FT                   VEYEKMQVSDMVVLNLQGDVVEGHYKPSSDTATHLELYARFPQLGGIVHTHSTYATSWA
FT                   QAGVAIPPLGTTHADYFAGAIPCTRPLSRQEVSGEYELETGKVIAASLTGIDPLHMPGI
FT                   LVAQHGPFCWGITPEQAVHNAVVLEEVAKMAWITGSIRRDQTPMDDYLLHKHFSRKHGP
FT                   DAYYGQK"
     atgacggatg cactgaaaca acgcgtattt gaagccaaca tggcgctgcc cgcttttggt        60
     ctggtgacct tcacgtgggg gaatgtcagc ggtattgatc gcgagcgcgg tattgttgtg       120
     atcaaaccga gcggcgtgga atacgagaaa atgcaggtca gcgatatggt cgtgctgaac       180
     ctgcaaggcg acgtcgtgga agggcattac aaaccctctt cagataccgc cacgcatctc       240
     gaactttacg cccgtttccc gcagcttggt ggcatcgtgc acacccattc gacctatgcg       300
     acctcatggg cgcaggccgg cgtcgccatc ccgccactcg gcaccacaca cgcggattat       360
     tttgccggtg ccattccctg cacccggcct ttatcgcgtc aggaagtcag cggagagtac       420
     gaactggaaa ccggcaaagt tatcgccgcg tcgctgaccg gcatcgatcc gctgcatatg       480
     ccgggtattc tggtcgccca gcatggcccg ttctgctggg gaatcacgcc ggaacaggcg       540
     gtacacaacg cggtggtgct ggaagaagtc gcgaaaatgg cgtggatcac cggttcaatc       600
     cgacgtgacc aaaccccgat ggacgattat ttgctgcaca agcacttcag ccgcaagcac       660
     gggccggatg cgtattacgg gcagaaataa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page