(data stored in SCRATCH zone)

EMBL: CP002505.PE229

CP002505.PE229       Location/Qualifiers
FT   CDS_pept        261920..262762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0232"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, beta subunit; KEGG:
FT                   cro:ROD_44601 putative malonate decarboxylase beta subunit
FT                   MdcD"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71862"
FT                   /db_xref="GOA:A0A0H3F504"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F504"
FT                   /inference="protein motif:TFAM:TIGR03133"
FT                   /protein_id="ADW71862.1"
FT                   /translation="MPTDTDQSFIELSARQRARKLLDAGTFRELLGPFERIMSPWLEPQ
FT                   GIVPQADDGMVVAKGQINGQPAVVVAIEGSFQGGSMGEVSGAKMAAALEMAAEDNRNGI
FT                   PTQAVLLLETGGVRLQEANLGLAAIADIHAAIVDLRRYTPVIGVVAGTVGCFGGMSIAA
FT                   ALCSYLIVTREARLGLNGPQVIEQEAGIDEYDSRDRPFIWSMTGGEVRYHSGFVDALVK
FT                   DSLNEVKDSVLAFIKAGVPATHRSDNYDYYLPKLTGFDTAQQASREVTEALFNREDRA"
     atgccaactg atactgatca gagctttatc gaactgagcg cccgtcagcg cgcccgcaaa        60
     ttgctggacg ccgggacttt ccgtgaactg ctcgggccgt tcgaacgcat tatgtctccg       120
     tggctggaac cgcagggcat cgtgccgcag gccgatgacg gcatggtcgt cgccaaaggt       180
     cagattaacg gccagcctgc tgtcgttgtg gcgattgaag gcagcttcca gggcggcagc       240
     atgggcgaag tgtccggtgc caaaatggct gctgcgctgg aaatggctgc agaagataac       300
     cgtaacggca tcccgacgca ggccgttctg ctgctggaaa ccggtggtgt gcgtttgcag       360
     gaggccaatc tgggtcttgc cgctatcgcc gatattcacg ccgccattgt tgatttgcgc       420
     cgctatacgc cggtgatcgg cgtcgttgcc ggtactgttg gttgctttgg cgggatgtcg       480
     attgccgccg cgctgtgcag ctatctgatt gtcacccgtg aagcccgtct gggactgaac       540
     ggtccgcagg ttatcgaaca ggaagccggt atcgatgaat acgattcccg cgaccgtccg       600
     tttatctgga gcatgaccgg tggcgaagtg cgttatcaca gcgggtttgt tgatgcgctg       660
     gtgaaagatt ccctgaatga agtgaaagac agcgtgctgg cctttattaa agcgggcgta       720
     cctgcgacac atcgttctga taattatgat tattacctgc caaaactgac cggttttgac       780
     accgcgcagc aggccagccg tgaagtgacg gaagccttgt ttaaccggga ggatcgcgca       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page