(data stored in SCRATCH zone)

EMBL: CP002505.PE243

CP002505.PE243       Location/Qualifiers
FT   CDS_pept        280390..282759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0246"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="KEGG: ypy:YPK_3054 penicillin-binding protein 1C;
FT                   TIGRFAM: penicillin-binding protein 1C; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71876"
FT                   /db_xref="GOA:A0A0H3F9T0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9T0"
FT                   /inference="protein motif:TFAM:TIGR02073"
FT                   /protein_id="ADW71876.1"
FT                   /translation="MITFRAFSKTAKRLLQNIAMAVFLLAMIIVACRLWPHPLLSQGQP
FT                   FSTAYYDRQGTLMRITLANDDRYRLWTPLEQVSPLAVKSLLLHEDRWFYINPGFNPFSL
FT                   MRGFWRSYVTGGKMQGGSTITMQLARMHWHLNTRTPSGKIMQVLRAVQLELSYSKHDIL
FT                   EAYLNTAPYGRNIESIGAASLIYFNKAPKDLTLPEALTLAVLPQSPSYRIDSKTGVVGA
FT                   ALTQARNRLFQRWQAHYATDSSQTSLFRLPLALRQPEQMPYIAPHFIEQLRQQNPQIIR
FT                   TDTRIDTTLDAGLQRLIERQVNAFITRNESRGIHNAAVVLADTRDMGVRALVGSADYYN
FT                   RTIQGQVNGTNAKRSPGSALKPFIYALGMEQGVLHPMTILKDVPSAFGAYAPENFDRRF
FT                   LGPVTATDALNFSRNIPAVYVASQLRQPTFYQFLRLSGVADMSSENHYGLSLVLGGGEV
FT                   TMQELAKLYALLANRGVLQPLRMQKSDPRQTTPVRLLSEEASFITLDMLRQHRRPGDTL
FT                   AQAPSSLPVYWKTGTSWGFRDAWSVGVFGPYVLVVWEGNFDSKGNNVFVGADAAAPLFF
FT                   NIIDSITASYPDLQEPKRPFPKGLKRVDICLASGDLPTPWCQQKGKTWFIPGKSPIKVD
FT                   TVYRPVRLDKLTGEVACPPYEEDETRTEVFEFWPSDLANVFAQAGLPKRKPPANHCKDE
FT                   GVDVSGNPPRITSPLKNTTYTLRQSQQGRDRISFNAVTDADSKTVYWFVDDIYLGSSAS
FT                   KSAIDWRPINNGQYRIRAVDDHGRADSRLVSIEIVN"
     atgatcacct ttcgcgcatt ttctaaaaca gccaaacgtc tgctgcaaaa catcgcgatg        60
     gcggtttttt tactggcgat gattattgtg gcatgccgcc tctggccaca tccgctcctt       120
     tctcagggcc agcctttttc caccgcctat tatgaccgtc agggtacgct gatgcgcatc       180
     acgctggcga acgacgaccg ttatcgcctc tggacgccgc ttgaacaggt ttctccactg       240
     gcggtgaaaa gcttgttgct gcatgaagat cgctggtttt atatcaaccc cggttttaac       300
     ccgttcagcc tgatgcgggg gttctggcgc agctatgtga cgggtggaaa gatgcagggc       360
     ggctccacta tcacgatgca actggcgcgg atgcactggc atctgaacac ccgcacgcca       420
     tcgggtaaaa tcatgcaggt tctgcgcgcg gtgcaactgg aactgagtta ttccaaacat       480
     gacattctcg aagcctatct gaataccgca ccgtacgggc gaaatattga aagcattggc       540
     gcggccagcc tgatttattt caacaaagcc ccgaaggatc tgacgttacc ggaagcactg       600
     acgctggcgg ttctgccaca atcgccgagc taccgtatcg actctaaaac gggtgttgtc       660
     ggtgcggcgc tgacgcaggc tcgtaaccgg cttttccagc gctggcaggc ccattatgca       720
     accgacagca gccagacttc attgttcaga ttgccgctgg cactgcgcca gcccgaacag       780
     atgccttata ttgcgccgca tttcatcgag cagttacgcc agcagaaccc gcaaattatc       840
     cgcacggata cccgtatcga caccacgctg gatgccggtt tgcagcggct gatcgagcgg       900
     caggtgaatg cgtttatcac ccgcaacgaa agccgtggga ttcacaatgc tgctgttgtg       960
     ctggccgata cccgtgatat gggtgtgcgt gcgctggtcg gttccgccga ttactacaac      1020
     cgtacgattc aggggcaggt gaacggcacc aatgcgaaac gctcgcccgg ttcggcgctc      1080
     aaaccgttta tttacgcgct gggcatggag cagggcgtgc tgcatccgat gactattctc      1140
     aaagatgtac cttcagcatt tggggcatat gcgccggaga atttcgaccg gcgatttctc      1200
     ggaccagtga ctgccaccga tgcgctgaac ttcagccgca acattccggc cgtgtatgtg      1260
     gcttcacagc ttcgccagcc gacgttctat cagtttctgc gtctttccgg cgtggcggat      1320
     atgtccagcg agaaccatta tggtttatcg ctggtgctgg gcggtggcga agtgacgatg      1380
     caggaactgg caaaactgta cgcattgctg gcgaaccgtg gcgtcttaca gccgttacgg      1440
     atgcagaaat ccgatccgcg gcagacaacg ccggtcaggt tactgagtga agaggccagt      1500
     ttcatcaccc tcgatatgct gcgccagcac cgccgtccgg gcgatacgct ggcacaggca      1560
     ccgtcttcac tgccagttta ctggaaaacc ggcacgtcct ggggctttcg tgatgcctgg      1620
     agcgtggggg ttttcgggcc ttacgtgctt gttgtgtggg aagggaattt cgacagcaaa      1680
     ggcaacaacg tgtttgtcgg tgccgatgcg gccgcgccgc tgttcttcaa tattatcgac      1740
     agcattaccg ccagttatcc tgatttgcag gaacccaaac gcccgtttcc caaagggttg      1800
     aaacgggtgg atatctgcct ggccagcggt gatttgccga cgccatggtg ccagcaaaaa      1860
     ggcaaaacct ggtttattcc gggcaagtcg ccgatcaaag tcgatacggt ttaccgcccg      1920
     gtgcgcctcg ataaactgac cggtgaagtg gcatgcccgc cttatgagga ggacgaaacc      1980
     cgtacggaag tgtttgagtt ctggccatcg gatctggcga atgtttttgc acaggcaggg      2040
     ttgccaaaac gtaagccccc ggcgaatcac tgcaaggatg agggcgttga cgtgagtggc      2100
     aatccgccac gcatcacgtc accgctgaaa aataccacct acacgctgcg gcagtcacag      2160
     caaggccgtg accggatttc ctttaatgcg gtcacggatg cggacagtaa aacggtgtac      2220
     tggtttgtcg atgacatcta cctcggcagc tccgccagca aatccgctat cgactggcgg      2280
     cctatcaata acggccagta tcgcattcgc gcggtggacg accacgggcg cgcggacagc      2340
     cggttggtga gtattgagat tgtgaactga                                       2370
//

If you have problems or comments...

PBIL Back to PBIL home page