(data stored in SCRATCH zone)

EMBL: CP002505.PE245

CP002505.PE245       Location/Qualifiers
FT   CDS_pept        complement(283899..286442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0248"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: ecy:ECSE_3430 putative fimbrial usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71878"
FT                   /db_xref="GOA:A0A0H3F4P6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P6"
FT                   /inference="protein motif:PFAM:PF00577"
FT                   /protein_id="ADW71878.1"
FT                   /translation="MLTDEKFLQKSLSGDIKKTSAPLVLKLGGLLASTALGLLAAHPAR
FT                   SENVYFDPQFIERQAGDVGDVDLSLFQSNDQAQLPGNYDTALYVNKKLKIRHSISYLSK
FT                   PDGTLEPQITPDILRLLGVNVDAFPALKNHQPDAPLGSLAQYIPAADVKFDFYLMQLNF
FT                   SIPQAAILQKAEDYIDPEKWDDGAPVLFSNYSYSGGQRSYRNGSDDSSQYLNLQNGFNV
FT                   GPWRLRNYTTYSNSGGEKRWDTISTYAERDIKTLKSKFQIGENSTSGEILSSVPFSGVQ
FT                   LFSDDNMLPNSQRGFAPTIRGIANSNAEVTIRQNDHIIYQSFVPPGAFEISDLYPSSYS
FT                   GNLEITVKEADGTERRFNQPFSAIPIMQRPGRLKYSATAGTYRARDNNEKEPTFAQGTA
FT                   IYGISNTITSYGGSVVSEDYLSGLIGMGYNLRWLGGISADVTHARSTLDNNQTTSGQSY
FT                   RVQYSKNIEMTDTDFSLASYRYSSAGYYDFDESTQYLDGDNVPELDYHKRSKIQFNINQ
FT                   TLWQGASLYLSGYKQDYWNNSGKEKNLSLGLNNSLFGISYNLSYSYSQLQDQDNDQQIS
FT                   LNVRIPLSRWLPQSWGTYNVSHQKGEGTRHQVGLSGTALDDRRLSYSVQQSYTAHNSES
FT                   GSNLYSSYRSSFGNLNAGYNYSRDSQQLSYGIAGGIVAHSRGATLSQPLGDSFALIDTN
FT                   GASGARLQNLPGVRTDWRGFAVVPYLTAYNENRIAMDTTTLPDDVDIENTSAIVIPNSG
FT                   AMVTAHFDARVGARVLVTLVRPNGATVPFGAVAATDKQSNIVDEGGVVYLSGIPLEKPV
FT                   LLHVKWGNNASQQCQAQLNISASTSQVNSLTAQCI"
     atgctcacgg atgaaaaatt tttacagaag agcttgtctg gagacattaa aaagacctcc        60
     gcgccactcg tgctaaaact gggtggcctg ctggccagta cggctttggg attactcgcc       120
     gctcacccgg cccgttcaga aaatgtctat ttcgatcctc agttcatcga gcgtcaagcc       180
     ggtgatgttg gggatgtcga cctctcgttg ttccagagta atgaccaggc acagttacca       240
     ggtaactatg acactgcatt gtatgtgaat aaaaaattaa aaatacgtca ttcaatcagc       300
     tacttgtcca aaccagacgg cacgcttgag ccacagatca cgcctgatat attgcggtta       360
     ctgggcgtca atgttgatgc gtttccggcg ttaaaaaatc atcagccgga cgcacctttg       420
     ggttcgcttg cacaatatat ccctgctgca gacgtcaaat ttgatttcta cctcatgcag       480
     cttaatttca gcattccgca ggcagcgatc cttcaaaaag ctgaagacta tattgatccg       540
     gaaaaatggg atgacggcgc acctgtactt ttctcaaatt actcctattc aggcggccag       600
     aggagttacc gaaatggcag tgatgattcc agccaatacc tgaatctgca aaatggcttc       660
     aacgtaggcc cgtggcgctt acgtaattat acgacttaca gcaacagcgg aggtgagaag       720
     cgttgggata cgatctcaac ctacgccgaa cgggatatca aaaccttaaa atcaaaattc       780
     caaatcggtg aaaattcgac ctccggagaa attctcagca gtgtcccgtt ctccggggtt       840
     cagctttttt ctgacgataa tatgctgcca aacagccagc gcggtttcgc acccaccata       900
     cggggtattg caaactcaaa tgcagaagtc actatccggc aaaatgatca cattatttat       960
     cagtcttttg tccctccggg tgcctttgag attagcgatc tttatccctc atcctacagc      1020
     ggaaatcttg agataacggt gaaagaagct gacgggactg aacgccggtt taatcagcct      1080
     ttttcagcga ttcccatcat gcaacgccct ggtcgtttga aatacagcgc aacagcgggg      1140
     acttatcgcg cgagagataa caatgagaaa gagccaacct ttgctcaagg tacggctatc      1200
     tatggtattt caaacaccat tacgtcctac ggtggctctg tggtatctga agattacctc      1260
     tcaggactca tcggcatggg ttataacctc cggtggctgg gcggcatttc ggctgatgtt      1320
     acccatgccc gttctacact ggacaataat caaaccacct caggtcagtc atatcgcgtc      1380
     cagtattcga aaaatattga aatgaccgac acagatttca gtctggcaag ctatcggtac      1440
     tcaagtgcgg gatattacga cttcgatgag tccacacaat atcttgatgg cgacaatgtt      1500
     ccggaacttg attatcacaa acgcagtaaa atccagttca atatcaatca gacattgtgg      1560
     caaggcgcga gcctgtatct gtcaggatac aaacaggact actggaataa cagcggcaag      1620
     gagaagaatc tctcactggg cttaaacaac agtctgtttg gtatcagcta taacctgagc      1680
     tattcctaca gccagttaca ggatcaggat aacgatcaac agatatccct gaacgtccgt      1740
     attccgctca gccgttggtt gccacaaagc tgggggacat acaatgtctc tcaccagaaa      1800
     ggcgaaggga cacggcatca ggttggatta agcggaaccg cgcttgacga tcgtcgcctg      1860
     agctattcag ttcagcaaag ttataccgct cataacagtg aaagcggcag caacctttac      1920
     tcttcttacc gctcctcctt tggcaatctc aatgcaggtt acaattacag cagggattct      1980
     cagcaactca gctacggcat tgccggcggg atcgtggcgc attcccgggg tgccactttg      2040
     tctcaacctc tcggtgattc ctttgcattg attgatacca atggagccag tggggcacgt      2100
     ctgcaaaatc ttcctggcgt cagaacagac tggcgtggtt ttgctgtcgt cccgtatctg      2160
     actgcgtata acgaaaaccg tatcgccatg gacaccacca ccctgcctga cgacgtagat      2220
     atcgaaaata cctcagccat tgtgatcccg aattccggcg ccatggtgac ggcacatttt      2280
     gatgcccgag tgggggccag agttttggtg acacttgtca gaccaaacgg ggccacagtc      2340
     ccgtttggtg ccgtggcggc cactgataaa caaagcaata tcgtggatga gggcggcgtc      2400
     gtttatctgt caggtatccc gttagaaaaa cccgttttac ttcatgtcaa atgggggaat      2460
     aacgcatctc agcaatgtca ggctcaactc aacatttctg cctcaacctc tcaggtgaat      2520
     tcgctgacgg ctcagtgtat ttaa                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page