(data stored in SCRATCH zone)

EMBL: CP002505.PE263

CP002505.PE263       Location/Qualifiers
FT   CDS_pept        302849..303709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pam:PANA_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71896"
FT                   /db_xref="GOA:A0A0H3F9W6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9W6"
FT                   /inference="similar to AA sequence:KEGG:PANA_3670"
FT                   /protein_id="ADW71896.1"
FT                   /translation="MTGFLSERIEPLMEKPGWQRVFILTACLVMMVLTLYQFGLRGLWQ
FT                   QQETLKREIDIAQQTLSLAQVTLMRMIPLERLEQELAGNATSLRKSLPLEQAFSRPLKD
FT                   SQAVLIRWQPVSQPKQEPQGELQLQVTFTELMHFLHALLQRPEQPAFSELNLHTTGGGG
FT                   MKASVLLTQTAPAAEFVSSVVASKAVRDPFNTPQTPDCAGVSPLSEWLLSGISDVGGQR
FT                   YGWLLSPQGRWNKVETGSLVGMPQWTVEVLSSVQVELSLSDARCGLQRQIIRLGKGNDS
FT                   PGKGK"
     atgaccggtt ttctatcaga gcgtattgaa ccgctgatgg aaaaacccgg ctggcagcgg        60
     gtattcattc tgaccgcatg tttagtgatg atggttttaa cgctgtatca gttcggattg       120
     cgcggattat ggcagcaaca ggaaaccctg aaacgggaga ttgacatcgc acaacagacc       180
     ctttccctgg ctcaggtgac gctaatgcgc atgattccac tggaaagact ggagcaggaa       240
     ctggccggta atgcgacatc actgcgcaaa agcctgcctc ttgagcaagc gttttcccgg       300
     ccactgaaag actctcaggc ggtgctgatt cgctggcaac ccgtttcgca accgaaacaa       360
     gaaccgcagg gtgagttgca gttgcaggtg acttttaccg aactgatgca ttttcttcat       420
     gcgctgttgc aacgtcccga acagcctgcg tttagcgagc tgaatctgca taccaccggt       480
     ggtggtggga tgaaagcatc agtgttactg acacaaaccg cgccagcggc ggagtttgtt       540
     agcagtgtcg tcgcgtcgaa agccgtgcgt gatccgttta atacgccaca gacacccgac       600
     tgtgctggtg tttctccgtt atctgaatgg ctgttaagcg ggatttcaga tgtcggaggg       660
     caacgttatg gctggctgct ttctccgcag gggcgctgga ataaagtcga aacaggttca       720
     ctcgttggga tgccgcaatg gacggttgaa gtgctcagca gtgtgcaggt tgaacttagc       780
     ctcagtgacg cacgttgcgg cttacagcgt cagattatca ggctgggtaa aggtaatgat       840
     tctccaggga aaggaaaata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page