(data stored in SCRATCH zone)

EMBL: CP002505.PE271

CP002505.PE271       Location/Qualifiers
FT   CDS_pept        310477..311493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0274"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   pwa:Pecwa_4054 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71904"
FT                   /db_xref="GOA:A0A0H3F7H8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7H8"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADW71904.1"
FT                   /translation="MSKPIVFSGAQPSGELTIGNYMGALRQWVKMQDDYECIYCIVDLH
FT                   AITVRQDAEKLRKATLDTLALYLAVGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGEL
FT                   GRMTQFKDKSARYETSNSESITAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRD
FT                   IAARFNALYGDVFTVPEPFIPKSGARVMSLQEPTKKMSKSDDNRKNVIGLLEDPKAVTK
FT                   KIKSAMTDSEEPPVIRYDIKNKPGVSNLLDILSGVTGKAIPELEAEFEGQMYGHLKGAV
FT                   AEAVSGMLTEVQERFNRFRSDEAYLQQVMKEGAEKARARASVTLKKAYEAIGFVTLP"
     atgagtaaac ccatcgtatt tagtggcgca cagccctcag gcgaattgac cattggcaac        60
     tacatgggtg cgctgcgtca atgggtcaaa atgcaggacg attacgaatg catttactgc       120
     atcgtcgatt tgcacgcgat caccgtgcgt caggatgcgg aaaagctgcg caaagcgacg       180
     ctggacacgc tggcgctgta tctggcggtc ggcattgatc cgaagaaaag taccatcttc       240
     gtgcagtctc atgttcctga acatagtcag ctaagctggg cgctgaattg ctacacctat       300
     ttcggtgagc tgggtcgtat gacgcagttt aaagacaaat cagcgcgcta tgaaacctcc       360
     aacagcgaaa gcatcactgc tggcctgttt gattatccgg tgctgatggc ggcggatatt       420
     ctgctgtacc agaccaatca ggtgccggtt ggtgaagacc agaaacaaca tctggaactg       480
     agccgcgata tcgccgcacg tttcaacgcg ctttatggtg atgtgtttac cgtgccggag       540
     ccgttcattc cgaaatccgg tgcacgcgtg atgtcattgc aggaaccgac caagaagatg       600
     tcaaagtcgg atgacaaccg taaaaacgtg attggcttgc tggaagatcc gaaagcggtg       660
     accaaaaaaa ttaaaagcgc gatgacggat tctgaagagc cgccagtcat ccgttacgat       720
     attaaaaaca agccgggcgt ttctaacctg ctggatatcc tttctggtgt gacgggcaaa       780
     gccattcctg agctggaagc tgaatttgaa ggccagatgt atggtcatct gaaaggtgcc       840
     gttgctgaag cggtttcagg catgctcact gaagtgcagg aacgttttaa ccgcttccgc       900
     agtgacgaag cttacctgca acaggtcatg aaagaagggg ctgagaaagc ccgtgcccgt       960
     gccagcgtga cgctgaagaa ggcctacgaa gctattggct tcgtcactct tccctaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page