(data stored in SCRATCH zone)

EMBL: CP002505.PE272

CP002505.PE272       Location/Qualifiers
FT   CDS_pept        complement(311573..312967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0275"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: ypb:YPTS_3938 siroheme synthase; TIGRFAM:
FT                   uroporphyrin-III C-methyltransferase; siroheme synthase;
FT                   PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Sirohaem synthase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71905"
FT                   /db_xref="GOA:A0A0H3F423"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F423"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADW71905.1"
FT                   /translation="MDYLPLFCQLKNRACLLVGAGDVAERKARLLLEAGAKLTVNALTF
FT                   TPQFQIWADEGKVRLLRGEFSPLLVDEKWLVIAATDSDLVNQEVSEAADHRRVFCNVVD
FT                   APESASVIMPSIIDRSPLMIAVSSGGNAPVLARLLRERLESILPQHLGKLAQVAGGLRA
FT                   RVKTHFPDASERRRWWEKLFNHHRLAQSLANNDNVQSHEYLEELFREPVDKHGEVILVG
FT                   AGPGDAGLLTLKGLQQMQLADVVVYDRLVSDSVLNLARRDAERIFVGKRAGHHCVPQER
FT                   INEILLEQAQMGKRVVRLKGGDPFIFGRGGEELEALKAAGIAFSVVPGITAASGCSAYS
FT                   GIPLTHRDHAQSVRLITGHAKQDGVLDWACMAQTQQTLVFYMGLTQAGEIQRRLLENGL
FT                   AAETPVALVENGTSQQQRVVTGKLTELENLAKKVQSPSLIIVGSVVSLRQKLNWFASET
FT                   VAMPSD"
     atggattacc tgcccctttt ttgtcagtta aaaaacagag cctgcttact ggtcggtgcc        60
     ggtgatgttg cagagcgtaa agcgcgtttg ctgctggaag ctggcgcaaa actaacggtg       120
     aacgccctca cctttacgcc gcaatttcag atctgggcag atgaaggcaa agtccgcctg       180
     ttacgcggtg aattttcacc gctgctggtg gatgaaaaat ggctggtgat cgctgcgacc       240
     gattccgatc tggtgaatca ggaagtcagc gaagccgcag atcaccgccg cgtgttctgc       300
     aacgtggtcg atgcgccgga aagtgccagc gtgatcatgc cgtcgatcat tgaccgttct       360
     ccgctgatga tcgcggtgtc ttccggcggt aatgcgccgg tactcgcgcg tttgctgcgc       420
     gaacgtctgg aatccattct gccacagcat ctgggcaaac tggcacaggt cgcgggcgga       480
     ttgcgggcgc gggtaaaaac acattttcct gatgcttctg agcgccgtcg ctggtgggaa       540
     aaactgttta atcatcatcg cctggcgcag tcgctggcga acaatgacaa cgtgcaaagc       600
     cacgaatacc ttgaagaatt attccgcgag cccgtggata aacatggcga agtgattctg       660
     gtcggcgccg gaccgggcga tgccggatta ctgacgctca aaggcttgca acagatgcaa       720
     ctggccgacg tggtggttta cgaccggctg gtttctgaca gcgtgcttaa tctggcacgt       780
     cgcgacgcgg agcggatttt cgtgggcaaa cgtgccggac accattgtgt gccgcaggag       840
     cgcatcaatg aaatcctgct ggaacaggcg cagatgggca aacgcgttgt ccgtctcaaa       900
     gggggcgatc cgtttatctt tggtcgtggc ggcgaagaac tggaagcact gaaagccgca       960
     ggcatcgcgt tctccgtggt gccgggcatc acggcggcct ccggttgttc cgcttacagc      1020
     ggtattccgc tgacccaccg cgatcacgcg caaagcgtgc ggctgatcac cggccatgcg      1080
     aagcaggatg gagttttaga ctgggcctgc atggcgcaaa ctcagcaaac actggtgttt      1140
     tatatggggc ttacgcaggc cggagagatc cagcgccggt tgctggagaa tggcctggca      1200
     gcagaaacgc ctgtcgcact ggtagaaaac ggcaccagcc agcaacaacg agtggtgaca      1260
     gggaagctca cagagctcga aaatctggcg aaaaaggtgc aaagccccag tctgattatt      1320
     gtcggcagcg tggtgagctt acgtcagaaa ctcaactggt ttgccagcga aaccgtagcg      1380
     atgccatcgg attga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page