(data stored in SCRATCH zone)

EMBL: CP002505.PE285

CP002505.PE285       Location/Qualifiers
FT   CDS_pept        327970..328377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0288"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: spe:Spro_4579
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71918"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S7"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADW71918.1"
FT                   /translation="MHARVKWVEGLTFLGESASGHQISMDGNAGDKAPSPMEMLLMSAG
FT                   GCSAIDVVSILQKGRNDVRDCEVKLTSQRREEAPRLFTHINLHFIVTGKDLTDKIVERA
FT                   VSLSAEKYCSVSLMLGKAATITHSFEVIAAE"
     atgcatgcac gtgtcaaatg ggttgaagga ctgacatttt taggtgagtc tgcatcgggt        60
     catcagattt caatggatgg aaacgcgggt gataaagccc caagcccgat ggaaatgtta       120
     ctgatgtccg caggggggtg tagtgcaatc gacgtggtgt caattttgca aaaaggtcgt       180
     aatgacgtgc gtgattgtga agtgaagctg acctcacaac gccgcgaaga agcgccgcgt       240
     ctgttcactc acatcaatct gcattttatc gtcaccggta aggatctgac cgataagatt       300
     gttgaacgtg cggtcagcct gtctgccgaa aaatactgtt ctgtgtctct gatgctgggt       360
     aaagcggcca caatcaccca cagctttgaa gtgattgcag ccgaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page