(data stored in SCRATCH zone)

EMBL: CP002505.PE292

CP002505.PE292       Location/Qualifiers
FT   CDS_pept        334697..335575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0295"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="TIGRFAM: 2-hydroxy-3-oxopropionate reductase; KEGG:
FT                   ecc:c0624 2-hydroxy-3-oxopropionate reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71925"
FT                   /db_xref="GOA:A0A0H3F436"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F436"
FT                   /inference="protein motif:TFAM:TIGR01505"
FT                   /protein_id="ADW71925.1"
FT                   /translation="MKIGFIGLGIMGAPMAQHLVDAGHSLHFSTLGNVPASLTDAGAKA
FT                   CATPAEVTVHADVIIIMVPDTPDVATVLFGDNGCASVPLKGKTIVDMSSISPIETKTFA
FT                   QRVQQLGGEYLDAPVSGGEIGAQQGTLTIMVGGKESVFNDIKPLFELMGKNITLVGDCG
FT                   AGQTCKVANQIIVALNIEAVSEALLFASRAGADPARVRQALMGGFASSRILEVHGERMI
FT                   KRTFAPGFKVALHQKDLNLALQSAKALSISLPNTATCQELFNVCAANGGSQLDHSSLIQ
FT                   SLEMMSNHKIG"
     atgaaaattg gatttatcgg cttaggaatt atgggcgcac cgatggcgca acatctggtg        60
     gatgccgggc acagtctgca tttctccaca ctcggcaacg tgcctgcttc actgaccgat       120
     gccggtgcca aagcctgtgc gacaccggca gaagtcaccg ttcacgccga cgtcattatt       180
     atcatggtgc cggatacgcc agacgtggca acggtgctgt ttggtgacaa tggctgcgcc       240
     agcgtgccgc tgaaaggcaa aaccattgtc gatatgagtt ccatctcacc gattgaaacc       300
     aaaacgtttg cgcagcgtgt gcagcaactg gggggggaat atctggatgc gccggtttcc       360
     ggcggtgaaa ttggcgcgca gcagggcacg ctgaccatca tggtgggcgg taaggaatca       420
     gtcttcaacg atatcaaacc gctgtttgag ctgatgggta agaacatcac gctggtgggc       480
     gattgcggag ccgggcaaac ctgcaaagtg gcgaaccaga tcattgtggc gctgaatatt       540
     gaagctgtct cggaagcgct gctgtttgct tcccgcgccg gtgccgatcc tgcccgtgtt       600
     cgtcaggctt tgatgggcgg attcgcctca tcgcgcattc tggaagtgca cggtgagcgc       660
     atgatcaagc gcacttttgc gccgggcttt aaagtcgcgc tgcaccagaa agatctcaac       720
     ctggcgctgc aaagtgccaa agccttatca atcagcctgc ctaatacggc gacctgtcag       780
     gagttattca atgtctgtgc agcaaacggc ggatcgcagt tagatcattc gtcattaatt       840
     cagtcgctgg aaatgatgtc gaatcacaaa atcggttaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page