(data stored in SCRATCH zone)

EMBL: CP002505.PE296

CP002505.PE296       Location/Qualifiers
FT   CDS_pept        339923..341068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0299"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="TIGRFAM: glycerate kinase; KEGG: sea:SeAg_B0571
FT                   glycerate kinase II; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71929"
FT                   /db_xref="GOA:A0A0H3F7J5"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7J5"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ADW71929.1"
FT                   /translation="MKIIIAPDSFKESLSAECAAMAIEDGFRAVFPELEAVRLPVADGG
FT                   EGTVDALIAATGGHRIDIEVTDPQGHRVRGFYGVNGKGDCAVIEMAAASGLMLVPAGQR
FT                   DPLAATSFGTGELIRHALDGGIRHIILGIGGSATVDGGIGMVQALGGRFTDAQGIDLPW
FT                   GGAALAQLAAIDLSQLDPRLAQCRIEVACDVENPLTGPCGAAAVFGPQKGASVQDVQVL
FT                   DAALAHLAAVIFRHLGVNVLEWPGGGAAGGMGVAARLFLRGNMRSGIDIIMDAIGLDEA
FT                   MQGATLVITGEGRLDQQTINGKAPVGVARLAQRYHVPVIGLAGILGEGVEVVHQHGLEA
FT                   VFSILPRLAPLETVLEQGEENLRYAAQNLARVYRLGMKASS"
     atgaaaatta ttattgcgcc cgattcattc aaggaaagtt taagtgcgga atgtgcggcg        60
     atggcgattg aagacgggtt tcgcgctgtg ttcccggaac tcgaggctgt ccgtctgccg       120
     gttgctgacg gcggcgaagg cacggtggat gcgctgattg ccgcgaccgg cgggcatcgc       180
     attgatattg aagtgacaga cccgcaggga catcgcgtgc gtggttttta cggcgtgaac       240
     ggcaaaggtg attgtgcggt gattgaaatg gccgccgcca gcggtctgat gctggtgccc       300
     gccggacagc gtgacccgct cgcggccacc agtttcggca ccggtgagtt aatccgtcat       360
     gcactggacg gcggtatccg ccatatcatt ttaggcattg gtggcagcgc gaccgttgat       420
     ggcggcattg gcatggtaca ggcgctcggc ggccgtttta ccgatgcgca gggcattgat       480
     ctgccgtggg gcggcgccgc gctggcgcaa ctggcggcta ttgatctgag tcagttggat       540
     ccgcgtttag cgcagtgccg gattgaagtg gcgtgcgatg tggaaaatcc gctgaccggt       600
     ccgtgcggtg cggcggcagt attcggcccg caaaaaggcg catcggtgca agatgttcag       660
     gttctggacg cggcgctggc ccatctggcg gcggttattt tccgccatct cggggttaac       720
     gtgcttgagt ggccaggcgg tggcgcagcg ggcggaatgg gtgtggcggc tcggttgttc       780
     ctgcgtggca acatgcgttc cggtatcgac attattatgg atgccatcgg gctggatgag       840
     gcgatgcaag gtgctacgct ggtgatcacc ggcgaagggc ggctggatca gcagaccatt       900
     aacggcaaag caccggtcgg tgtggcgcgg ctggcacaac gctaccatgt gccggtgatc       960
     gggctggcgg gcattctggg cgaaggagtg gaagtcgtgc atcagcacgg gctggaagcc      1020
     gtattcagta ttctcccacg cctcgcgcca ctggaaacgg tgctggagca gggggaggaa      1080
     aacctgcgtt atgctgcgca aaatcttgcc cgagtttacc ggctgggcat gaaggcctct      1140
     tcctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page