(data stored in SCRATCH zone)

EMBL: CP002505.PE298

CP002505.PE298       Location/Qualifiers
FT   CDS_pept        complement(341950..343176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0301"
FT                   /product="allantoate amidohydrolase"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: allantoate amidohydrolase; amidase,
FT                   hydantoinase/carbamoylase family; KEGG: kpu:KP1_1372
FT                   allantoate amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71931"
FT                   /db_xref="GOA:A0A0H3FA42"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA42"
FT                   /inference="protein motif:TFAM:TIGR03176"
FT                   /protein_id="ADW71931.1"
FT                   /translation="MSPFYQHVESQLDWLSVFGADPAGGISRLLYSPEWLETQNQLKQR
FT                   MTQNGFATRFDAVGNLYGRIEGSDRKDEVILSGSHIDTVVSGGHLDGQFGVLAAFIAMR
FT                   YLKDTFGTPRRTLEVVSLAEEEGSRFPYVFWGSKNIVGQADPADVRNITDAQGVKFTDA
FT                   MQQCGFTLPGSPLPARRDIKAFVELHIEQGSVLERNQQQLGVVHAIVGQRRYTVTLTGT
FT                   ANHAGTTPMSYRKDTLQAFSQICVTATESAEAHGDPLVLTFGKVVPVPGTVNVVPGKTV
FT                   FSIDCRHTDQQALLAFTTELDATMRRICQERGIGIDIDLWMDEAPVPMDKQLVAQLDAL
FT                   CREQNSRYRVMHSGAGHDAQIFAACVPTCLLFVPSIAGISHNPAENTAVADLAAGVEML
FT                   AKMLHQLAY"
     atgtcgccct tttatcagca cgtagaaagt cagctcgact ggttatcggt atttggcgca        60
     gatccggctg gcggtatttc ccgcctgctt tattcccccg aatggctgga aacgcaaaat       120
     cagttaaaac agcggatgac gcagaatggg tttgccaccc gtttcgacgc cgtcggcaat       180
     ttatatggcc gcatcgaagg cagtgaccgc aaagacgagg tcattctctc cggctcgcat       240
     atcgatacgg tggtcagcgg tggccatctc gacggacagt tcggtgtgct cgccgccttt       300
     atcgccatgc gctatctgaa agacaccttt ggcacgccgc gccgcacgct ggaagtggtg       360
     tcgctggccg aagaagaagg cagccgtttt ccctatgttt tctggggcag taaaaacatc       420
     gtcggacagg ccgatcctgc cgatgtgcgc aacatcaccg atgcgcaggg cgtgaaattt       480
     accgatgcga tgcagcaatg cggtttcacg ctgcccggtt ctccgttgcc cgcccgccgc       540
     gacatcaaag cctttgtcga actgcatatc gagcagggca gcgtgctcga acgcaatcag       600
     cagcaacttg gcgtggtgca tgcgattgtc ggtcagcgcc gctataccgt gaccctgacc       660
     ggcaccgcca atcacgcggg cactacgccg atgagttacc gcaaagatac ccttcaggca       720
     ttcagtcaga tttgcgtgac ggctaccgaa agcgccgaag cgcacggcga tccgctggtg       780
     ctgaccttcg gcaaagtggt gccggtgccg ggtaccgtta atgtcgtgcc gggtaaaacc       840
     gtgttcagca ttgattgccg ccacaccgat cagcaggcgc tgctggcgtt taccacagaa       900
     ctggacgcca ccatgcggcg gatttgccag gaacgcggca tcggcatcga cattgattta       960
     tggatggatg aagcgccggt gcccatggac aaacaactgg tggcgcaact cgacgccctg      1020
     tgccgtgaac aaaacagccg ttaccgcgtg atgcacagcg gcgccgggca cgacgcgcag      1080
     attttcgccg cctgcgtacc gacctgcctg ctgttcgttc ccagcattgc gggtatcagc      1140
     cacaacccgg cagaaaacac cgctgttgcc gatctggccg cgggcgtgga aatgctggcg      1200
     aaaatgctgc atcaactggc ttattaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page