(data stored in SCRATCH zone)

EMBL: CP002505.PE324

CP002505.PE324       Location/Qualifiers
FT   CDS_pept        complement(365685..366518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0327"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="KEGG: psp:PSPPH_0818 type IV pilus prepilin
FT                   peptidase PilD; PFAM: peptidase A24A domain protein;
FT                   peptidase A24A prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71957"
FT                   /db_xref="GOA:A0A0H3F597"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F597"
FT                   /inference="protein motif:PRIAM:3.4.23.43"
FT                   /protein_id="ADW71957.1"
FT                   /translation="MDGGWQQLSYITSLPDGFYHTCVAVLGLLLGSFLNVVVYRLPLMI
FT                   QNDGQLTEHGFNLSLPASHCPACIHPLKYWQNIPVLSWLLLRGKCHYCKTTISKRYPLT
FT                   EAGCAAMFLGLSFLFTTPLSLFSALLLFWFLLALSLIDLATYLLPDRLTLPLLWAGLLV
FT                   HSLYGSVTLQNALYGAVAGYLALWFLYWSVKLVSGKEGMGYGDFKLLAALGAWVGWQML
FT                   PYLCILAALAGIVFTLVRVSIYKMSEQTPFGPCLALAGALIYISQESKTIWLMLS"
     atggacggag gatggcagca attgtcttat atcacatcat tacccgacgg gttttatcac        60
     acctgcgtcg ctgttttggg attgctgctg ggcagctttc ttaatgtcgt cgtttatcgc       120
     ttgccgctga tgattcagaa cgatggtcaa ctgacagagc atggctttaa tctgagcctt       180
     ccggcatcac actgccccgc ctgtatacat ccgctaaaat actggcagaa cattccggtt       240
     ttgagctggt tgttgttacg ggggaaatgc cattattgca aaaccacgat ctctaaaagg       300
     taccccctta cagaagcagg atgcgccgcc atgtttcttg gtctgtcgtt tctgtttacc       360
     actcccctga gtttattcag tgccttatta ctgttttggt ttcttctggc actaagcctg       420
     attgatttgg caacttacct gcttcctgac cggctgacac tgccattgct gtgggccggg       480
     ttactcgtcc actctctgta cggcagcgtg acacttcaga atgcattata tggcgcggtc       540
     gcaggttatc tggcgttgtg gtttttgtac tggagtgtca agttagtcag cggcaaagag       600
     ggaatggggt acggggattt taaactcctg gcagcacttg gcgcctgggt gggctggcag       660
     atgttgccat atctgtgtat tctcgccgcg cttgcgggga tcgttttcac actggtaagg       720
     gtaagtattt ataaaatgtc agagcaaaca cctttcggcc cctgcctggc actggctggt       780
     gcgctgattt acatcagcca ggagagcaaa acaatctggc tgatgttgag ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page