(data stored in SCRATCH zone)

EMBL: CP002505.PE333

CP002505.PE333       Location/Qualifiers
FT   CDS_pept        complement(372437..373963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0336"
FT                   /product="general secretory pathway protein E"
FT                   /note="TIGRFAM: general secretory pathway protein E; PFAM:
FT                   type II secretion system protein E; KEGG: enc:ECL_02797
FT                   general secretion pathway protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71966"
FT                   /db_xref="GOA:A0A0H3FAB5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAB5"
FT                   /inference="protein motif:TFAM:TIGR02533"
FT                   /protein_id="ADW71966.1"
FT                   /translation="MNSDNEVLYRPVVEQASPVLPYTYAKQKGVTLLDNVLFCRQDISA
FT                   ETLLEVRRIMGEITAVEIVETTLFDEKLSATYQRSSGESQQIIDDIDNEVDLLSLSEEL
FT                   PDNEDLLASDENSPIIRLINAVLSEAVKEGASDIHIETFERMLSIRFRIDGVLRQILQP
FT                   ARKLAPFLVSRIKVMAKLDIAEKRLPQDGRISLRIGHRAIDIRVSTIPAQYGERVVMRL
FT                   LDKNNLCLEIPQLGLSPQDEQQLSALIRKPHGIILVTGPTGSGKSTTLYAVLSALNNNE
FT                   RNILTVEDPIEYELEGVGQTQVNPRVEMTFALGLRAILRQDPDVVMVGEIRDNETAQIA
FT                   VQASLTGHLVMSTLHTNSAVGAITRLRDMGLEPFLLASSLLGVVAQRLVRRLCPHCTRQ
FT                   SPLDVSHIPLFHFLPEPPATVFKAVGCSQCHFTGYKGRAAIHECMVVDNAIRQAIHENQ
FT                   DEFSIENIHRKTARSLRENGLLKTISGETTLEEVIRVTAEQEIATRGTPS"
     atgaacagtg ataacgaagt gctatataga cccgttgtgg aacaagcctc ccctgttctg        60
     ccttatacct acgccaaaca aaaaggcgta acgctgcttg ataacgtact tttttgccga       120
     caggacattt cagcggaaac actgctcgaa gtacgtcgga tcatgggtga aataacggcg       180
     gtcgaaatag tggaaacgac attgttcgat gaaaagttat cagcaaccta ccagcgtagc       240
     agcggcgagt cacaacaaat cattgatgat atcgataacg aggtcgatct tctgtctttg       300
     tctgaggaat tacctgataa cgaagactta ctggccagtg atgaaaattc gccgatcatc       360
     cgtctgatta atgcggtgct ttctgaagca gtcaaagagg gtgcttcgga tatccatatc       420
     gaaaccttcg aacgcatgct cagtatccgg tttcgtatcg atggcgtctt acggcaaatc       480
     ctgcaaccgg ctcgcaagct ggcaccgttc ttggtatcgc gcatcaaggt gatggcgaaa       540
     ctggatatcg ctgaaaaacg tttacctcag gatggtcgca tttcgttacg tatcggtcac       600
     cgggcgattg atatccgcgt atcgaccatt ccagctcaat atggtgagcg tgtggtgatg       660
     cgccttttgg ataaaaataa tttatgtctt gagattccac aacttggtct gtctccacag       720
     gacgaacaac agctatcggc attaatccgt aaacctcacg ggatcattct ggtcaccggg       780
     ccgaccggtt caggtaaaag cacgactctg tacgcagttc tttctgcact caacaataac       840
     gagcgtaaca ttcttactgt cgaagacccg attgagtatg aactggaggg cgtggggcaa       900
     acgcaagtta acccccgtgt agaaatgaca tttgcgctcg gtttgcgggc gattttgcgt       960
     caggacccgg atgtagtcat ggtcggtgag atccgcgaca atgaaacagc tcaaatcgcg      1020
     gtgcaggctt cactgaccgg ccatctggtg atgtcaacat tgcatacaaa tagtgccgtc      1080
     ggtgccatta cccgtttacg ggatatgggt ctggagccct tccttctcgc ctcctcatta      1140
     ttaggcgtgg tggctcagcg actcgtgcga cgcctttgcc cgcattgtac ccgacagtcc      1200
     ccgttagatg tgtctcacat tcctttattc cactttctgc ctgaaccacc agccactgtt      1260
     tttaaagccg tcggatgttc tcaatgccat ttcacgggct ataaaggcag ggcggctatc      1320
     cacgaatgca tggttgttga taacgctata cgtcaggcta ttcatgagaa tcaggatgaa      1380
     ttttccattg agaacattca tcgcaaaact gcccgaagct tgcgggaaaa tggactgctt      1440
     aaaaccatta gcggcgagac tacgctggaa gaagtgatca gagttactgc cgaacaagag      1500
     atagcgacac ggggaacgcc ctcatga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page