(data stored in SCRATCH zone)

EMBL: CP002505.PE339

CP002505.PE339       Location/Qualifiers
FT   CDS_pept        379554..380183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0342"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: spe:Spro_4544 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71972"
FT                   /db_xref="GOA:A0A0H3F5A9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A9"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADW71972.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKDLDNDGY
FT                   RAVQVTTGSKKANRVTKPEAGHFAKAGVEAGRGLWEFRLAEGEEFTAGQNISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   QLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
     atgattggtt tagtcggtaa gaaagtgggt atgactcgta tcttcactga agatggcgtt        60
     tctatccctg taaccgttat cgaaattgaa gcaaaccgcg ttactcaggt caaagacctg       120
     gacaacgacg gttaccgcgc tgtgcaggtt actactggta gcaaaaaagc taaccgtgta       180
     accaaaccag aagcgggtca cttcgctaaa gctggcgtag aagctggccg cggtctgtgg       240
     gaattccgcc ttgcagaagg tgaagagttc actgcaggtc agaacattag cgttgaaatt       300
     ttcgcagacg ttaagaaagt tgatgttacc ggtacttcta aaggtaaagg ttttgctggc       360
     acagttaagc gctggaattt ccgtacccaa gacgctaccc atggtaactc cttgtctcac       420
     cgtgttccgg gttctatcgg tcagaaccag actccgggca aagtgttcaa aggcaagaaa       480
     atggcaggcc aactgggtaa cgagcgtgta accgttcaaa gcctggacgt agtacgtgtt       540
     gacgctgagc gcaacctgct gctggtcaag ggtgctgttc cgggtgctac cggtggcaac       600
     ctgatcgtta aacctgctgt taaggcttaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page