(data stored in SCRATCH zone)

EMBL: CP002505.PE342

CP002505.PE342       Location/Qualifiers
FT   CDS_pept        381123..381947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0345"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: ypb:YPTS_3887 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71975"
FT                   /db_xref="GOA:A0A0H3F479"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F479"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADW71975.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIAAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKVGDQIQSGVDAAIKTGNTLPMRNIPVGSTVHNVEMKPGKGGQMARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQVDCRATLGEVGNSEHMLRVLGKAGAARWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
     atggcaattg ttaaatgtaa acctacatct ccgggtcgtc gccacgttgt taaagtggtt        60
     aaccctgagc tgcacaaggg taaaccttat gctccgctgc ttgaaaaact gagcaaaagc       120
     ggtggccgta acaacaatgg ccgtatcacc acccgtcata tcggtggtgg ccacaaacag       180
     cattatcgtc tggttgactt caaacgcaac aaagatggta tcgctgcagt ggttgagcgt       240
     ctggagtacg atccgaaccg ttccgcgaat atcgcgctgg ttctgtacaa agacggcgaa       300
     cgccgttata tcctggcgcc gaaaggcctg aaagtgggtg accagatcca atctggtgtt       360
     gatgctgcaa tcaagacagg taacaccctg cctatgcgca acatcccagt aggttcaacg       420
     gttcataacg tagaaatgaa accaggtaaa ggcggccaga tggctcgctc agccggtgcc       480
     tacgttcaga tcgttgctcg tgacggttcc tacgtaactc tgcgtctgcg ctctggcgaa       540
     atgcgtaaag ttcaagttga ttgccgcgcc accttaggtg aagtcggtaa ctctgaacat       600
     atgcttcgcg ttctgggtaa agcaggtgct gctcgttggc gtggtattcg tcctaccgtt       660
     cgcggtactg cgatgaaccc agtcgatcac ccacacggtg gtggtgaagg tcgtaacttt       720
     ggtaagcacc cggtaactcc atggggcgtt caaaccaaag gtaagaagac ccgtagcaac       780
     aagcgtactg ataaattcat tgtacgtcgc cgtagcaaaa aataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page