(data stored in SCRATCH zone)

EMBL: CP002505.PE354

CP002505.PE354       Location/Qualifiers
FT   CDS_pept        386352..386885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0357"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: ypb:YPTS_3875 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71987"
FT                   /db_xref="GOA:A0A0H3F5C3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5C3"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADW71987.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELSRTIHDAVVVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVVGVTDGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHQLPEGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
     atgtctcgtg ttgcaaaagc acccgtcgtc attcctgccg gcgtagaggt aaaactcaac        60
     ggtcaggtta tttcgattaa gggtaaaaac ggcgagctgt cacgtactat ccatgacgct       120
     gttgtagtta agcaggaaga aaatacactg actttcgctc cacgcgaagg cgctgtagac       180
     ggttgggccc aagcgggtac cactcgtgca ctgttgaact ctatggttgt aggtgttacc       240
     gacggcttca ctaaaaagct tcaactggta ggtgttggtt atcgtgctgc tgttaaaggc       300
     aacgtggtga atttagcctt aggcttctct cacccggtcg atcatcaact gccggaaggc       360
     atcactgcag aatgtccgac ccaaactgaa atcgtgctga aaggcgctga taaacaggtt       420
     atcggtcagg ttgctgcgga tttacgtgcc taccgtcgtc ctgagcctta taaaggcaag       480
     ggtgtccgtt acgccgacga agtcgtgcgt accaaagagg ctaagaagaa gtaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page