(data stored in SCRATCH zone)

EMBL: CP002505.PE360

CP002505.PE360       Location/Qualifiers
FT   CDS_pept        389760..389876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0363"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: sgl:SG2257 50S ribosomal protein L36; TIGRFAM:
FT                   ribosomal protein L36; PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71993"
FT                   /db_xref="GOA:A0A0H3F505"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F505"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADW71993.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGVVRVICSAEPKHKQRQG"
     atgaaagttc gtgcttccgt caagaaatta tgtcgtaact gcaaaattgt taagcgtaac        60
     ggtgtcgttc gcgtaatctg cagtgcagaa ccgaagcata aacagcgtca aggctga          117
//

If you have problems or comments...

PBIL Back to PBIL home page