(data stored in SCRATCH zone)

EMBL: CP002505.PE365

CP002505.PE365       Location/Qualifiers
FT   CDS_pept        392495..392884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0368"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: spe:Spro_4518 50S ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71998"
FT                   /db_xref="GOA:A0A0H3F510"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F510"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADW71998.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAESKAEVATAE"
     atgcgccatc gtaagagtgg tcgtcaactg aaccgtaaca gcagccaccg acaggctatg        60
     ttccgtaaca tggccggctc tttggttcgt catgagatca tcaagacgac cctgccgaaa       120
     gcgaaagagc tgcgtcgcgt tgttgagccg ctgattactc ttgccaagac cgacaatgtt       180
     gcaaatcgtc gtctggcatt cgcccgtact cgtgataacg agatcgtggc aaaactgttt       240
     aatgaactgg gtccgcgttt cgcgagccgt gctggtggtt acactcgtat tcttaagtgt       300
     ggcttccgtg caggcgacaa tgcgccgatg gcatacatcg agctcgttga tcgtgcagag       360
     tcaaaagcag aagtagcaac tgctgaataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page