(data stored in SCRATCH zone)

EMBL: CP002505.PE377

CP002505.PE377       Location/Qualifiers
FT   CDS_pept        401294..401863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0380"
FT                   /product="SUA5/yciO/yrdC domain protein"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: eca:ECA3996
FT                   putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72010"
FT                   /db_xref="GOA:A0A0H3F4A2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A2"
FT                   /inference="protein motif:PFAM:PF01300"
FT                   /protein_id="ADW72010.1"
FT                   /translation="MNKETEKSFSAVLEALHGQHVIAYPTEAVFGLGCDPDSEQAVEAL
FT                   LALKKRPKDKGLILIADNYQQLLPYIDDSSLTEQQLAHVVSFWPGPVTWVMPAKPSTPD
FT                   WLTGRFTSLAVRVTDHPLVKELCQKFGKPLVSTSANLNGQPPCRLSEEVRLQFGKDFPV
FT                   LDGDVGGRDNPSEIRDALTGNLIRQG"
     atgaataaag agacagaaaa atcattcagt gcagtgcttg aggcgcttca cggacaacat        60
     gttattgctt atccaacgga agcggttttc gggttggggt gtgacccaga tagcgaacaa       120
     gccgtcgagg cattgctggc gctgaaaaaa cgtccaaaag ataaaggact cattctgatt       180
     gctgacaatt atcagcagct ccttccttat attgatgact catctttaac ggagcaacag       240
     cttgcgcatg tcgtttcatt ctggccaggc cccgttacct gggttatgcc tgcaaaaccc       300
     tcgacacctg attggcttac cggccgtttc acttcgctgg cggtgcgtgt cacagaccat       360
     cctctggtaa aagaactctg ccaaaaattt ggaaaaccac tggtttcaac cagtgcgaac       420
     ctgaacgggc aacctccttg ccgtttgtct gaagaagtca ggcttcagtt tgggaaagat       480
     tttcccgtgc tggatggcga tgtaggagga agagataatc catctgaaat tcgggatgcc       540
     ctcactggca accttattcg tcaaggttaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page